KEGG   Pipistrellus kuhlii (Kuhl's pipistrelle): 118723941
Entry
118723941         CDS       T07682                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
pkl  Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl00250  Alanine, aspartate and glutamate metabolism
pkl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    118723941 (RIMKLA)
Enzymes [BR:pkl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     118723941 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     118723941 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST Rimk_N Dala_Dala_lig_C
Other DBs
NCBI-GeneID: 118723941
NCBI-ProteinID: XP_036302658
LinkDB
Position
Unknown
AA seq 362 aa
MCPQLWFLTDRRICEDYPQVQILRALQQRCAEQGVRFRAVFMDQIAVTVVGGHLGLQLNR
KALTTFPDVVLVRVNTPSLQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGKAVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGQV
IGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSF
VVCEANANVGFLAFDQACNLDVGAIIADYAVSLLPNMQTGKMAVLPGLSSPREKSEPDGC
AAARGVAESIYAINNGSTSSESEPELGEVRGPSASTAGPPPPMLPEPSYNINNRIASELK
LK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtgcccgcagctctggttcctgacggaccggcgcatctgcgaggactacccgcaggtg
cagatcctgcgcgccctccagcagcgctgcgcggagcagggcgtgcgcttccgcgcggtg
ttcatggaccagatcgcggtcaccgtcgttggcggccacctcggcctacagctgaaccgg
aaggcactcaccaccttcccggatgtggtgcttgtccgggtgaacaccccctcgctgcag
tcggacagcgacatcaccgtcctgcggcacctggagaagctgggctgccgcctcgtcaac
cgcccccagagcattctaaactgcatcaacaagttctggaccttccaggagctggctgga
cacggggtccccatgccagacaccttctcctatgggaaggctgttttccttgcaagagat
aaacatcacctctcagacatctgccacctcatccgccatgacgtgccctacctgttccag
aagtacgtgaaggagtcccatggaaaagacatccgggtggtggtggtcgggggccaggtg
ataggctctatgcttcgctgctccacagacggacggatgcagagcaactgctccctcggt
ggtgtgggtgtcatgtgcccactgacagagcaaggcaagcaattggctattcaggtgtcc
aatatcctgggcatggacttctgtggcattgatctcctcatcatggacgatggctccttt
gtggtgtgtgaggcaaacgccaacgtcggtttcctcgccttcgaccaggcttgcaactta
gacgtgggtgcgatcattgcagactatgctgtgtccttgctgccaaacatgcagactggg
aagatggccgtcctcccaggcctgtccagtcccagggagaagagcgagccagatggctgt
gcggcagctcgaggcgttgcagagagcatctacgccatcaacaacgggtctacctccagt
gagagtgagccggaactgggagaagtccggggtccctcagccagcacagcagggcccccg
ccccccatgctgcccgagcccagctacaacattaacaataggattgcttccgaattaaaa
ctgaagtga

DBGET integrated database retrieval system