Panthera leo (lion): 122217378 Help Entry 122217378         CDS       T10741                                  Symbol CASP3 Name (RefSeq) caspase-3 isoform X1   KO K02187   caspase 3 [EC:3.4.22.56] Organism plez  Panthera leo (lion) Pathway plez01524   Platinum drug resistance plez04010   MAPK signaling pathway plez04115   p53 signaling pathway plez04148   Efferocytosis plez04210   Apoptosis plez04215   Apoptosis - multiple species plez04623   Cytosolic DNA-sensing pathway plez04650   Natural killer cell mediated cytotoxicity plez04657   IL-17 signaling pathway plez04668   TNF signaling pathway plez04726   Serotonergic synapse plez04932   Non-alcoholic fatty liver disease plez04933   AGE-RAGE signaling pathway in diabetic complications plez04936   Alcoholic liver disease plez05010   Alzheimer disease plez05012   Parkinson disease plez05014   Amyotrophic lateral sclerosis plez05016   Huntington disease plez05020   Prion disease plez05022   Pathways of neurodegeneration - multiple diseases plez05132   Salmonella infection plez05133   Pertussis plez05134   Legionellosis plez05145   Toxoplasmosis plez05146   Amoebiasis plez05152   Tuberculosis plez05160   Hepatitis C plez05161   Hepatitis B plez05162   Measles plez05163   Human cytomegalovirus infection plez05164   Influenza A plez05165   Human papillomavirus infection plez05167   Kaposi sarcoma-associated herpesvirus infection plez05168   Herpes simplex virus 1 infection plez05169   Epstein-Barr virus infection plez05170   Human immunodeficiency virus 1 infection plez05200   Pathways in cancer plez05203   Viral carcinogenesis plez05205   Proteoglycans in cancer plez05206   MicroRNAs in cancer plez05210   Colorectal cancer plez05222   Small cell lung cancer plez05416   Viral myocarditis plez05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122217378 (CASP3)    04668 TNF signaling pathway     122217378 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     122217378 (CASP3)   09143 Cell growth and death    04210 Apoptosis     122217378 (CASP3)    04215 Apoptosis - multiple species     122217378 (CASP3)    04115 p53 signaling pathway     122217378 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     122217378 (CASP3)    04650 Natural killer cell mediated cytotoxicity     122217378 (CASP3)    04657 IL-17 signaling pathway     122217378 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     122217378 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122217378 (CASP3)    05206 MicroRNAs in cancer     122217378 (CASP3)    05205 Proteoglycans in cancer     122217378 (CASP3)    05203 Viral carcinogenesis     122217378 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     122217378 (CASP3)    05222 Small cell lung cancer     122217378 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122217378 (CASP3)    05161 Hepatitis B     122217378 (CASP3)    05160 Hepatitis C     122217378 (CASP3)    05164 Influenza A     122217378 (CASP3)    05162 Measles     122217378 (CASP3)    05168 Herpes simplex virus 1 infection     122217378 (CASP3)    05163 Human cytomegalovirus infection     122217378 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     122217378 (CASP3)    05169 Epstein-Barr virus infection     122217378 (CASP3)    05165 Human papillomavirus infection     122217378 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     122217378 (CASP3)    05133 Pertussis     122217378 (CASP3)    05134 Legionellosis     122217378 (CASP3)    05152 Tuberculosis     122217378 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     122217378 (CASP3)    05145 Toxoplasmosis     122217378 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     122217378 (CASP3)    05012 Parkinson disease     122217378 (CASP3)    05014 Amyotrophic lateral sclerosis     122217378 (CASP3)    05016 Huntington disease     122217378 (CASP3)    05020 Prion disease     122217378 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     122217378 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122217378 (CASP3)    05416 Viral myocarditis     122217378 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122217378 (CASP3)    04932 Non-alcoholic fatty liver disease     122217378 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     122217378 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     122217378 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:plez01002]     122217378 (CASP3) Enzymes [BR:plez01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      122217378 (CASP3) Peptidases and inhibitors [BR:plez01002]  Cysteine peptidases   Family C14: caspase family    122217378 (CASP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  122217378 NCBI-ProteinID:  XP_042790213 LinkDB All DBs Position B1:complement(15494312..15517791) Genome browser AA seq 278 aa AA seqDB search MENSENSVDAKSIKNSETRKIFHGSKSMDSGIYMDNSYKMDYPEMGLCIIINNKNFHEST GMPSRSGTDVDAANLRETFTNLKYEVRNKNDLTREQIVALLDSVSREDHSKRSSFICVLL SHGDEGIIYGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTE DDIACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLRLYAHKLEFVHILTRV NRKVALEFESFSLDSAFHGKKQIPCIVSMLTKELYFYH NT seq 837 nt NT seq  +upstreamnt  +downstreamnt atggagaacagtgaaaactcagtggatgcaaaatccattaaaaattcggaaaccagaaag atcttccatggaagcaaatcaatggactctggaatatacatggacaacagttacaaaatg gattaccctgaaatgggtttatgtataataattaataataagaactttcatgaaagtacc ggaatgccgtctcggtctggtacagatgtggatgcggcgaacctccgagaaacattcaca aacttgaaatacgaagtcaggaataaaaacgatcttacacgcgaacaaattgtggcattg ctggacagtgtttctagagaagatcatagcaaaaggagcagttttatttgcgtgcttcta agccacggtgatgaaggaatcatttatggaacaaacggacctgttgacctgaaaaaattg acaggtttcttcagaggggattattgtagaagtctaaccggcaaacccaaactcttcatt attcaggcctgccgaggcacggaactggactgcggcattgagactgacagtggtaccgag gatgacatcgcctgccagaaaataccagtggaagccgacttcttatatgcgtattccaca gcccctggttactactcctggcgaaattccaaggatggatcctggttcatccagtcactt tgctcgatgctcagactgtacgctcacaagcttgagttcgtgcacattcttactcgggtt aaccgaaaggtagctctagaatttgagtccttttctcttgactctgcttttcatggaaag aaacagattccatgtattgtgtctatgctcacaaaagaactatatttttatcactga

DBGET integrated database retrieval system