Parus major (Great Tit): 107204252 Help Entry 107204252         CDS       T04864                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pmaj  Parus major (Great Tit) Pathway pmaj03050   Proteasome pmaj04060   Cytokine-cytokine receptor interaction pmaj04217   Necroptosis pmaj04350   TGF-beta signaling pathway pmaj05164   Influenza A pmaj05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pmaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     107204252 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     107204252 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107204252 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107204252 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     107204252 (IFNG)    05168 Herpes simplex virus 1 infection     107204252 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pmaj03051]     107204252 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmaj04052]     107204252 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pmaj00536]     107204252 (IFNG) Proteasome [BR:pmaj03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     107204252 (IFNG) Cytokines and neuropeptides [BR:pmaj04052]  Cytokines   Interferons    107204252 (IFNG) Glycosaminoglycan binding proteins [BR:pmaj00536]  Heparan sulfate / Heparin   Cytokines    107204252 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Fib_alpha Sec8_N Lipoprotein_20 DUF948 ATG14 ADIP FtsL_2 Phage_GP20 Motif Other DBs NCBI-GeneID:  107204252 NCBI-ProteinID:  XP_015482595 Ensembl:  ENSPMJG00000012612 LinkDB All DBs Position 1A:complement(32982638..32986996) Genome browser AA seq 165 aa AA seqDB search MAFQTYSLFVLSVIMISFGHVENRLNLLQLQNDIDKLKADFNSSHSDVADGGPIFTERLS GWTERNEKRIILSQIISMYLKMLENTDRSKAHVRNISEELYTLKESLSDGSKKIEDLKDL TKLQMSDLKIQRKAVNELFSVLQKLGDTSSSHKRKRRQFQRLCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggctttccaaacctacagcttgtttgttctgtctgtcatcatgatttcttttggacat gttgaaaatagattgaatcttcttcagcttcaaaacgatatagacaaactgaaagctgat tttaactcaagtcattctgatgtagctgatggtggacctatttttacagagaggctgtca ggctggacagagagaaatgaaaaaaggattatcctgagtcagattatttccatgtacttg aaaatgcttgaaaacaccgacaggtcaaaggctcatgtcaggaacatatctgaggagctc tatactctgaaagaaagcctttctgatggctcaaagaagatagaagatctcaaggacctg acaaaacttcagatgagtgacttgaaaattcagcgcaaggctgtgaatgagctgttcagc gttttacaaaaactgggggatacctcaagttctcacaaaagaaaaagaagacaatttcag aggctgtgcaaatgctaa

DBGET integrated database retrieval system