Parus major (Great Tit): 107204430 Help Entry 107204430         CDS       T04864                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pmaj  Parus major (Great Tit) Pathway pmaj03420   Nucleotide excision repair pmaj04110   Cell cycle pmaj04114   Oocyte meiosis pmaj04120   Ubiquitin mediated proteolysis pmaj04141   Protein processing in endoplasmic reticulum pmaj04310   Wnt signaling pathway pmaj04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pmaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107204430 (RBX1)    04120 Ubiquitin mediated proteolysis     107204430 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     107204430 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107204430 (RBX1)    04350 TGF-beta signaling pathway     107204430 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     107204430 (RBX1)    04114 Oocyte meiosis     107204430 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmaj04121]     107204430 (RBX1)    03400 DNA repair and recombination proteins [BR:pmaj03400]     107204430 (RBX1) Enzymes [BR:pmaj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107204430 (RBX1) Ubiquitin system [BR:pmaj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107204430 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      107204430 (RBX1)    Cul2 complex      107204430 (RBX1)    Cul3 complex      107204430 (RBX1)    Cul4 complex      107204430 (RBX1)    Cul7 complex      107204430 (RBX1)    Cul8 complex      107204430 (RBX1)    Cul9 complex      107204430 (RBX1) DNA repair and recombination proteins [BR:pmaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107204430 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       107204430 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  107204430 NCBI-ProteinID:  XP_015483009 Ensembl:  ENSPMJG00000007453 LinkDB All DBs Position 1A:complement(47566360..47578057) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggatgtggacacccccagcggaaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaatgccgtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccacattatggatctatgcatagaatgtcaagccaaccaa gcatcggctacctctgaggagtgcacagttgcatggggcgtctgcaatcacgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagggaa tgggagttccaaaagtacggacactag

DBGET integrated database retrieval system