Parus major (Great Tit): 107207018 Help Entry 107207018         CDS       T04864                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism pmaj  Parus major (Great Tit) Pathway pmaj04060   Cytokine-cytokine receptor interaction pmaj04672   Intestinal immune network for IgA production pmaj04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107207018 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107207018 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     107207018 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmaj04052]     107207018 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:pmaj00536]     107207018 (CXCL12) Cytokines and neuropeptides [BR:pmaj04052]  Cytokines   Chemokines    107207018 (CXCL12) Glycosaminoglycan binding proteins [BR:pmaj00536]  Heparan sulfate / Heparin   Chemokines    107207018 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107207018 NCBI-ProteinID:  XP_015489098 Ensembl:  ENSPMJG00000016047 LinkDB All DBs Position 6:complement(14454342..14472537) Genome browser AA seq 131 aa AA seqDB search MDLRALALFAFALAVVSLSEEKPVSLTYRCPCRFYESNVARANIKHLKILSTPNCSLQIV ARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRGPLCPSRATPLKSPGRK NGGSRCKRQAL NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggacctccgcgccctggcgctgttcgccttcgccctggccgtcgtctccctctcggag gagaaacccgtcagcctgacttaccgatgtccctgtcgattctacgagagcaacgtggca agagccaatattaaacacctcaaaatcctctccacacccaactgctcacttcagattgtt gcaaggctcaagagcaacagcaagcaagtgtgcattgatcccaagttaaagtggatccag gaatatctggagaaagctttaaacaaaccacgtcatcgcactcataaaaaaaagcaacag aagaaacggggcccactctgcccttcccgtgcaacaccactaaagtctccagggagaaag aatggaggttcaagatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system