Phocoena phocoena (harbor porpoise): 136141701 Help Entry 136141701         CDS       T11058                                  Symbol CASP3 Name (RefSeq) caspase-3 isoform X1   KO K02187   caspase 3 [EC:3.4.22.56] Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01524   Platinum drug resistance pphc04010   MAPK signaling pathway pphc04115   p53 signaling pathway pphc04148   Efferocytosis pphc04210   Apoptosis pphc04215   Apoptosis - multiple species pphc04623   Cytosolic DNA-sensing pathway pphc04650   Natural killer cell mediated cytotoxicity pphc04657   IL-17 signaling pathway pphc04668   TNF signaling pathway pphc04726   Serotonergic synapse pphc04932   Non-alcoholic fatty liver disease pphc04933   AGE-RAGE signaling pathway in diabetic complications pphc04936   Alcoholic liver disease pphc05010   Alzheimer disease pphc05012   Parkinson disease pphc05014   Amyotrophic lateral sclerosis pphc05016   Huntington disease pphc05020   Prion disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05132   Salmonella infection pphc05133   Pertussis pphc05134   Legionellosis pphc05145   Toxoplasmosis pphc05146   Amoebiasis pphc05152   Tuberculosis pphc05160   Hepatitis C pphc05161   Hepatitis B pphc05162   Measles pphc05163   Human cytomegalovirus infection pphc05164   Influenza A pphc05165   Human papillomavirus infection pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05168   Herpes simplex virus 1 infection pphc05169   Epstein-Barr virus infection pphc05170   Human immunodeficiency virus 1 infection pphc05200   Pathways in cancer pphc05203   Viral carcinogenesis pphc05205   Proteoglycans in cancer pphc05206   MicroRNAs in cancer pphc05210   Colorectal cancer pphc05222   Small cell lung cancer pphc05416   Viral myocarditis pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136141701 (CASP3)    04668 TNF signaling pathway     136141701 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     136141701 (CASP3)   09143 Cell growth and death    04210 Apoptosis     136141701 (CASP3)    04215 Apoptosis - multiple species     136141701 (CASP3)    04115 p53 signaling pathway     136141701 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     136141701 (CASP3)    04650 Natural killer cell mediated cytotoxicity     136141701 (CASP3)    04657 IL-17 signaling pathway     136141701 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     136141701 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136141701 (CASP3)    05206 MicroRNAs in cancer     136141701 (CASP3)    05205 Proteoglycans in cancer     136141701 (CASP3)    05203 Viral carcinogenesis     136141701 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     136141701 (CASP3)    05222 Small cell lung cancer     136141701 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136141701 (CASP3)    05161 Hepatitis B     136141701 (CASP3)    05160 Hepatitis C     136141701 (CASP3)    05164 Influenza A     136141701 (CASP3)    05162 Measles     136141701 (CASP3)    05168 Herpes simplex virus 1 infection     136141701 (CASP3)    05163 Human cytomegalovirus infection     136141701 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     136141701 (CASP3)    05169 Epstein-Barr virus infection     136141701 (CASP3)    05165 Human papillomavirus infection     136141701 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     136141701 (CASP3)    05133 Pertussis     136141701 (CASP3)    05134 Legionellosis     136141701 (CASP3)    05152 Tuberculosis     136141701 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     136141701 (CASP3)    05145 Toxoplasmosis     136141701 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     136141701 (CASP3)    05012 Parkinson disease     136141701 (CASP3)    05014 Amyotrophic lateral sclerosis     136141701 (CASP3)    05016 Huntington disease     136141701 (CASP3)    05020 Prion disease     136141701 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     136141701 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136141701 (CASP3)    05416 Viral myocarditis     136141701 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136141701 (CASP3)    04932 Non-alcoholic fatty liver disease     136141701 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     136141701 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     136141701 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pphc01002]     136141701 (CASP3) Enzymes [BR:pphc01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      136141701 (CASP3) Peptidases and inhibitors [BR:pphc01002]  Cysteine peptidases   Family C14: caspase family    136141701 (CASP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_C14 SICA_beta Motif Other DBs NCBI-GeneID:  136141701 NCBI-ProteinID:  XP_065755895 LinkDB All DBs Position 21:23406627..23415137 Genome browser AA seq 275 aa AA seqDB search MENNENSVDSKSIKTSGTKILHGSKSMDSGISLDYSYKMDYPERGLCIIINNKNFHESTG MACRSGTDVDAANLWETFTNLKYEVRNKNDLTCEEILELMYSVSKEDHSKRSSFICVLLS HGEEGKIFGTNGPVDLKKLTGFFRGDCCISLTGKPKLFVIQACRGTELDCGIETDSGAED DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYAHKLELMHILTRVN RKVAIEFESFSNDSTFHAKKQIPCIVSMLTKELYF NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atggagaacaatgaaaattcagtggattcaaaatccattaaaacttcagggacaaagatc ttacatggaagcaaatcaatggactctggaatatccttggactatagttacaaaatggat tatcctgaaaggggtttatgtataataattaataataagaactttcatgaaagtactggg atggcatgtcggtctggtacagacgtagatgcagcaaacctctgggaaaccttcacgaac ttgaaatatgaagttaggaataaaaatgatcttacatgtgaagaaattttggaattaatg tacagtgtttctaaagaagatcatagcaaaaggagcagttttatttgcgtgcttctaagc catggcgaggaaggaaaaatttttggaacaaatggacctgtcgatctgaaaaaattaaca ggtttcttcagaggggactgttgtataagcctaactggcaaacctaaactttttgttatt caggcttgccgaggcacagaactggactgtggtattgagacagacagtggtgctgaggat gacatggcctgtcagaaaataccagttgaggcggacttcttgtatgcatattctacagca cctggttactattcctggcgaaattcaaaggacggatcctggttcatccagtcactttgt gcaatgctgaaacagtacgctcacaagcttgagcttatgcatattctcactcgggttaac cgaaaggtagcaatagaattcgagtccttttccaatgattctacttttcatgcaaagaaa cagattccttgtattgtgtctatgctcacaaaagaactgtatttttaa

DBGET integrated database retrieval system