Phodopus roborovskii (desert hamster): 127220536 Help Entry 127220536         CDS       T08852                                  Symbol Casp3 Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01524   Platinum drug resistance prob04010   MAPK signaling pathway prob04115   p53 signaling pathway prob04148   Efferocytosis prob04210   Apoptosis prob04215   Apoptosis - multiple species prob04623   Cytosolic DNA-sensing pathway prob04650   Natural killer cell mediated cytotoxicity prob04657   IL-17 signaling pathway prob04668   TNF signaling pathway prob04726   Serotonergic synapse prob04932   Non-alcoholic fatty liver disease prob04933   AGE-RAGE signaling pathway in diabetic complications prob04936   Alcoholic liver disease prob05010   Alzheimer disease prob05012   Parkinson disease prob05014   Amyotrophic lateral sclerosis prob05016   Huntington disease prob05020   Prion disease prob05022   Pathways of neurodegeneration - multiple diseases prob05132   Salmonella infection prob05133   Pertussis prob05134   Legionellosis prob05145   Toxoplasmosis prob05146   Amoebiasis prob05152   Tuberculosis prob05160   Hepatitis C prob05161   Hepatitis B prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05165   Human papillomavirus infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05168   Herpes simplex virus 1 infection prob05169   Epstein-Barr virus infection prob05170   Human immunodeficiency virus 1 infection prob05200   Pathways in cancer prob05203   Viral carcinogenesis prob05205   Proteoglycans in cancer prob05206   MicroRNAs in cancer prob05210   Colorectal cancer prob05222   Small cell lung cancer prob05416   Viral myocarditis prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127220536 (Casp3)    04668 TNF signaling pathway     127220536 (Casp3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     127220536 (Casp3)   09143 Cell growth and death    04210 Apoptosis     127220536 (Casp3)    04215 Apoptosis - multiple species     127220536 (Casp3)    04115 p53 signaling pathway     127220536 (Casp3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     127220536 (Casp3)    04650 Natural killer cell mediated cytotoxicity     127220536 (Casp3)    04657 IL-17 signaling pathway     127220536 (Casp3)   09156 Nervous system    04726 Serotonergic synapse     127220536 (Casp3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127220536 (Casp3)    05206 MicroRNAs in cancer     127220536 (Casp3)    05205 Proteoglycans in cancer     127220536 (Casp3)    05203 Viral carcinogenesis     127220536 (Casp3)   09162 Cancer: specific types    05210 Colorectal cancer     127220536 (Casp3)    05222 Small cell lung cancer     127220536 (Casp3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127220536 (Casp3)    05161 Hepatitis B     127220536 (Casp3)    05160 Hepatitis C     127220536 (Casp3)    05164 Influenza A     127220536 (Casp3)    05162 Measles     127220536 (Casp3)    05168 Herpes simplex virus 1 infection     127220536 (Casp3)    05163 Human cytomegalovirus infection     127220536 (Casp3)    05167 Kaposi sarcoma-associated herpesvirus infection     127220536 (Casp3)    05169 Epstein-Barr virus infection     127220536 (Casp3)    05165 Human papillomavirus infection     127220536 (Casp3)   09171 Infectious disease: bacterial    05132 Salmonella infection     127220536 (Casp3)    05133 Pertussis     127220536 (Casp3)    05134 Legionellosis     127220536 (Casp3)    05152 Tuberculosis     127220536 (Casp3)   09174 Infectious disease: parasitic    05146 Amoebiasis     127220536 (Casp3)    05145 Toxoplasmosis     127220536 (Casp3)   09164 Neurodegenerative disease    05010 Alzheimer disease     127220536 (Casp3)    05012 Parkinson disease     127220536 (Casp3)    05014 Amyotrophic lateral sclerosis     127220536 (Casp3)    05016 Huntington disease     127220536 (Casp3)    05020 Prion disease     127220536 (Casp3)    05022 Pathways of neurodegeneration - multiple diseases     127220536 (Casp3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127220536 (Casp3)    05416 Viral myocarditis     127220536 (Casp3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127220536 (Casp3)    04932 Non-alcoholic fatty liver disease     127220536 (Casp3)    04933 AGE-RAGE signaling pathway in diabetic complications     127220536 (Casp3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     127220536 (Casp3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:prob01002]     127220536 (Casp3) Enzymes [BR:prob01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      127220536 (Casp3) Peptidases and inhibitors [BR:prob01002]  Cysteine peptidases   Family C14: caspase family    127220536 (Casp3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 SICA_beta Motif Other DBs NCBI-GeneID:  127220536 NCBI-ProteinID:  XP_051038341 UniProt:  A0AAU9Z5N9 LinkDB All DBs Position Unknown AA seq 277 aa AA seqDB search MENNETSMDSKSIKNFEVKTIHGSKSMDSGIYLDNSYKMDYPEMGVCIIINNKNFHKSTG MTPRSGTDVDAANLRETFMGLKYEVRNKNDLTREEIVELLKNVSKEDHSRRSSFVCVILS HGDEGVIFGTNGPIDLKKLTSYFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTED DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLEFMHILTRVN RKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagaacaacgaaacatcaatggattccaaatccattaaaaattttgaagtaaagacc atacatggaagcaaatcaatggactctggaatatatctggacaatagttacaaaatggat tatcctgaaatgggtgtgtgcataataattaataataagaactttcataaaagcactgga atgacacctcgctctggcactgatgtcgatgcagccaacctcagggagacattcatgggc ctgaaatatgaagtccggaacaagaatgatcttactcgtgaagaaattgtggaattgctg aaaaatgtttctaaagaagatcacagcaggaggagcagcttcgtttgtgtgattctaagc catggagatgaaggtgtaatttttggaacaaatgggcctattgacctgaaaaaactaact agttacttcagaggggactattgccgaagtctgactggaaagcccaaactattcatcatc caggcctgccgcggcacagagctagactgtggcattgagacagacagcggaactgaagat gacatggcgtgtcagaagataccagtggaagccgacttcctttacgcttactccacagca cctggttactactcctggagaaattcaaaggatgggtcctggttcatccagtcactgtgt gccatgctgaaactgtatgcacacaagcttgagtttatgcacattctcactcgagttaac cggaaggtagcgacagaatttgagtccttctcccttgactctacttttcatgcaaagaaa cagattccatgtattgtgtccatgctcacaaaagaactgtacttttatcactaa

DBGET integrated database retrieval system