Pan troglodytes (chimpanzee): 449517 Help Entry 449517            CDS       T01005                                  Symbol IFNG Name (RefSeq) interferon gamma precursor   KO K04687   interferon gamma Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03050   Proteasome ptr04060   Cytokine-cytokine receptor interaction ptr04066   HIF-1 signaling pathway ptr04217   Necroptosis ptr04350   TGF-beta signaling pathway ptr04380   Osteoclast differentiation ptr04612   Antigen processing and presentation ptr04630   JAK-STAT signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04657   IL-17 signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04659   Th17 cell differentiation ptr04660   T cell receptor signaling pathway ptr04940   Type I diabetes mellitus ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05143   African trypanosomiasis ptr05144   Malaria ptr05145   Toxoplasmosis ptr05146   Amoebiasis ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05164   Influenza A ptr05168   Herpes simplex virus 1 infection ptr05200   Pathways in cancer ptr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptr05321   Inflammatory bowel disease ptr05322   Systemic lupus erythematosus ptr05323   Rheumatoid arthritis ptr05330   Allograft rejection ptr05332   Graft-versus-host disease ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     449517 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     449517 (IFNG)    04630 JAK-STAT signaling pathway     449517 (IFNG)    04066 HIF-1 signaling pathway     449517 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     449517 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     449517 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     449517 (IFNG)    04612 Antigen processing and presentation     449517 (IFNG)    04660 T cell receptor signaling pathway     449517 (IFNG)    04658 Th1 and Th2 cell differentiation     449517 (IFNG)    04659 Th17 cell differentiation     449517 (IFNG)    04657 IL-17 signaling pathway     449517 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     449517 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     449517 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     449517 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     449517 (IFNG)    05164 Influenza A     449517 (IFNG)    05168 Herpes simplex virus 1 infection     449517 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     449517 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     449517 (IFNG)    05144 Malaria     449517 (IFNG)    05145 Toxoplasmosis     449517 (IFNG)    05140 Leishmaniasis     449517 (IFNG)    05142 Chagas disease     449517 (IFNG)    05143 African trypanosomiasis     449517 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     449517 (IFNG)    05323 Rheumatoid arthritis     449517 (IFNG)    05321 Inflammatory bowel disease     449517 (IFNG)    05330 Allograft rejection     449517 (IFNG)    05332 Graft-versus-host disease     449517 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     449517 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     449517 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ptr03051]     449517 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     449517 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     449517 (IFNG) Proteasome [BR:ptr03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     449517 (IFNG) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interferons    449517 (IFNG) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Cytokines    449517 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Y1_Tnp Tup_N Motif Other DBs NCBI-GeneID:  449517 NCBI-ProteinID:  NP_001180594 Ensembl:  ENSPTRG00000005193 UniProt:  Q9TTB0 H2Q6F3 A0A6D2XNN1 LinkDB All DBs Position 10:complement(74889475..74893735) Genome browser AA seq 166 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca ggtcattcagatgtagcagataatggaactcttttcttaggcattttgaagaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat tattcggtaactgacttgaatgtccaacgcaaggcaatacatgaactcatccaagtgatg gctgaactgtcgccagcagttaaaacggggaagcgaaaaaggagtcagatgctgtttcga ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system