Pan troglodytes (chimpanzee): 452025 Help Entry 452025            CDS       T01005                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01522   Endocrine resistance ptr04110   Cell cycle ptr04115   p53 signaling pathway ptr04151   PI3K-Akt signaling pathway ptr04218   Cellular senescence ptr04530   Tight junction ptr04660   T cell receptor signaling pathway ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr04934   Cushing syndrome ptr05160   Hepatitis C ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05166   Human T-cell leukemia virus 1 infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05169   Epstein-Barr virus infection ptr05200   Pathways in cancer ptr05203   Viral carcinogenesis ptr05212   Pancreatic cancer ptr05214   Glioma ptr05218   Melanoma ptr05219   Bladder cancer ptr05220   Chronic myeloid leukemia ptr05222   Small cell lung cancer ptr05223   Non-small cell lung cancer ptr05224   Breast cancer ptr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     452025 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     452025 (CDK4)    04115 p53 signaling pathway     452025 (CDK4)    04218 Cellular senescence     452025 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     452025 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     452025 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     452025 (CDK4)    05203 Viral carcinogenesis     452025 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     452025 (CDK4)    05225 Hepatocellular carcinoma     452025 (CDK4)    05214 Glioma     452025 (CDK4)    05220 Chronic myeloid leukemia     452025 (CDK4)    05218 Melanoma     452025 (CDK4)    05219 Bladder cancer     452025 (CDK4)    05224 Breast cancer     452025 (CDK4)    05222 Small cell lung cancer     452025 (CDK4)    05223 Non-small cell lung cancer     452025 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     452025 (CDK4)    05160 Hepatitis C     452025 (CDK4)    05164 Influenza A     452025 (CDK4)    05162 Measles     452025 (CDK4)    05163 Human cytomegalovirus infection     452025 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     452025 (CDK4)    05169 Epstein-Barr virus infection     452025 (CDK4)    05165 Human papillomavirus infection     452025 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     452025 (CDK4)    04934 Cushing syndrome     452025 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     452025 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptr01001]     452025 (CDK4) Enzymes [BR:ptr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      452025 (CDK4) Protein kinases [BR:ptr01001]  Serine/threonine kinases: CMGC group   CDK family    452025 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  452025 NCBI-ProteinID:  XP_509173 Ensembl:  ENSPTRG00000005147 VGNC:  8366 UniProt:  H2QZZ4 A0A6D2XU49 LinkDB All DBs Position 10:38279836..38284067 Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta aggacatatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc gaccagttaggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt aatccggagtga

DBGET integrated database retrieval system