Pan troglodytes (chimpanzee): 452972 Help Entry 452972            CDS       T01005                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03083   Polycomb repressive complex ptr04010   MAPK signaling pathway ptr05200   Pathways in cancer ptr05202   Transcriptional misregulation in cancer ptr05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     452972 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     452972 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     452972 (MAX)    05202 Transcriptional misregulation in cancer     452972 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     452972 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ptr03000]     452972 (MAX)    03036 Chromosome and associated proteins [BR:ptr03036]     452972 (MAX) Transcription factors [BR:ptr03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     452972 (MAX) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      452972 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH Filament bZIP_2 JetA SlyX Jnk-SapK_ap_N DUF5595 GAGA_bind SLX9 DUF4763 Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  452972 NCBI-ProteinID:  XP_003314427 Ensembl:  ENSPTRG00000006449 VGNC:  3386 UniProt:  H2Q8G8 A0A6D2XMS1 LinkDB All DBs Position 14:complement(45815752..45911431) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagaatatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system