Pan troglodytes (chimpanzee): 453047 Help Entry 453047            CDS       T01005                                  Symbol FOS Name (RefSeq) protein C-Fos   KO K04379   proto-oncogene protein c-fos Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01522   Endocrine resistance ptr04010   MAPK signaling pathway ptr04024   cAMP signaling pathway ptr04210   Apoptosis ptr04380   Osteoclast differentiation ptr04620   Toll-like receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04659   Th17 cell differentiation ptr04660   T cell receptor signaling pathway ptr04662   B cell receptor signaling pathway ptr04668   TNF signaling pathway ptr04713   Circadian entrainment ptr04725   Cholinergic synapse ptr04728   Dopaminergic synapse ptr04915   Estrogen signaling pathway ptr04917   Prolactin signaling pathway ptr04921   Oxytocin signaling pathway ptr04926   Relaxin signaling pathway ptr04928   Parathyroid hormone synthesis, secretion and action ptr04932   Non-alcoholic fatty liver disease ptr04935   Growth hormone synthesis, secretion and action ptr05031   Amphetamine addiction ptr05132   Salmonella infection ptr05133   Pertussis ptr05135   Yersinia infection ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05161   Hepatitis B ptr05162   Measles ptr05166   Human T-cell leukemia virus 1 infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease ptr05200   Pathways in cancer ptr05207   Chemical carcinogenesis - receptor activation ptr05208   Chemical carcinogenesis - reactive oxygen species ptr05210   Colorectal cancer ptr05224   Breast cancer ptr05231   Choline metabolism in cancer ptr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     453047 (FOS)    04668 TNF signaling pathway     453047 (FOS)    04024 cAMP signaling pathway     453047 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     453047 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     453047 (FOS)    04660 T cell receptor signaling pathway     453047 (FOS)    04658 Th1 and Th2 cell differentiation     453047 (FOS)    04659 Th17 cell differentiation     453047 (FOS)    04657 IL-17 signaling pathway     453047 (FOS)    04662 B cell receptor signaling pathway     453047 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     453047 (FOS)    04917 Prolactin signaling pathway     453047 (FOS)    04921 Oxytocin signaling pathway     453047 (FOS)    04926 Relaxin signaling pathway     453047 (FOS)    04935 Growth hormone synthesis, secretion and action     453047 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     453047 (FOS)   09156 Nervous system    04725 Cholinergic synapse     453047 (FOS)    04728 Dopaminergic synapse     453047 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     453047 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     453047 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     453047 (FOS)    05207 Chemical carcinogenesis - receptor activation     453047 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     453047 (FOS)    05231 Choline metabolism in cancer     453047 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     453047 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     453047 (FOS)    05224 Breast cancer     453047 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     453047 (FOS)    05170 Human immunodeficiency virus 1 infection     453047 (FOS)    05161 Hepatitis B     453047 (FOS)    05171 Coronavirus disease     453047 (FOS)    05162 Measles     453047 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     453047 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     453047 (FOS)    05135 Yersinia infection     453047 (FOS)    05133 Pertussis     453047 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     453047 (FOS)    05142 Chagas disease     453047 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     453047 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     453047 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     453047 (FOS)    05418 Fluid shear stress and atherosclerosis     453047 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     453047 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     453047 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ptr03000]     453047 (FOS)    04131 Membrane trafficking [BR:ptr04131]     453047 (FOS) Transcription factors [BR:ptr03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     453047 (FOS) Membrane trafficking [BR:ptr04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     453047 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  453047 NCBI-ProteinID:  NP_001091891 Ensembl:  ENSPTRG00000047703 VGNC:  10307 UniProt:  A5A6H0 A0A2I3SPQ0 LinkDB All DBs Position 15:73231626..73234066 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg tccccggccggggatagcctctcttactaccactcacccgcagactccttctccagcatg ggttcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcccgcc ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccacc ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgactgggggcctgccagaggttgccaccccggagtctgaagaggccttcacc ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcattagc agcatggagctgaagaccgagccctttgatgacttcctgttcccagcatcatccaggccc agtggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca gcagactgggagcctctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcagctgcccaccgcaag ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system