Pan troglodytes (chimpanzee): 456588 Help Entry 456588            CDS       T01005                                  Symbol PLA2G5 Name (RefSeq) phospholipase A2 group V   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr00564   Glycerophospholipid metabolism ptr00565   Ether lipid metabolism ptr00590   Arachidonic acid metabolism ptr00591   Linoleic acid metabolism ptr00592   alpha-Linolenic acid metabolism ptr01100   Metabolic pathways ptr04014   Ras signaling pathway ptr04270   Vascular smooth muscle contraction ptr04972   Pancreatic secretion ptr04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:ptr00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     456588 (PLA2G5)    00565 Ether lipid metabolism     456588 (PLA2G5)    00590 Arachidonic acid metabolism     456588 (PLA2G5)    00591 Linoleic acid metabolism     456588 (PLA2G5)    00592 alpha-Linolenic acid metabolism     456588 (PLA2G5)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     456588 (PLA2G5)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     456588 (PLA2G5)   09154 Digestive system    04972 Pancreatic secretion     456588 (PLA2G5)    04975 Fat digestion and absorption     456588 (PLA2G5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     456588 (PLA2G5) Enzymes [BR:ptr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      456588 (PLA2G5) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     456588 (PLA2G5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_2 Motif Other DBs NCBI-GeneID:  456588 NCBI-ProteinID:  XP_001160738 Ensembl:  ENSPTRG00000000278 VGNC:  9883 UniProt:  K7CEV9 H2PY78 A0A6D2XIL2 LinkDB All DBs Position 1:complement(211109500..211173043) Genome browser AA seq 138 aa AA seqDB search MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVKLCACDRKLVYCLKR NLRSYNPQYQYFPNILCS NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgaaaggcctcctcccactggcttggttcctggcttgtagtgtgcctgctgtgcaagga ggcttgctggacctaaaatcaatgatcgagaaggtgacagggaagaacgccctgacaaac tacggcttctacggctgttactgcggctggggcggccgaggaacccccaaggatggcacc gattggtgctgttgggcgcatgaccactgctatgggcggctggaggagaagggctgcaac attcgcacacagtcctacaaatacagattcgcgtggggcgtggtcacctgcgagcccggg cccttctgccatgtgaagctctgtgcctgtgaccggaagctcgtctactgcctcaagaga aacctacggagctacaacccacagtaccaatactttcccaacatcctctgctcctag

DBGET integrated database retrieval system