Pan troglodytes (chimpanzee): 461255 Help Entry 461255            CDS       T01005                                  Symbol CXCL3 Name (RefSeq) C-X-C motif chemokine 3   KO K05505   C-X-C motif chemokine 1/2/3 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04064   NF-kappa B signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04668   TNF signaling pathway ptr04936   Alcoholic liver disease ptr05134   Legionellosis ptr05146   Amoebiasis ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     461255 (CXCL3)    04668 TNF signaling pathway     461255 (CXCL3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     461255 (CXCL3)    04061 Viral protein interaction with cytokine and cytokine receptor     461255 (CXCL3)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     461255 (CXCL3)    04657 IL-17 signaling pathway     461255 (CXCL3)    04062 Chemokine signaling pathway     461255 (CXCL3)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     461255 (CXCL3)   09171 Infectious disease: bacterial    05134 Legionellosis     461255 (CXCL3)   09174 Infectious disease: parasitic    05146 Amoebiasis     461255 (CXCL3)   09163 Immune disease    05323 Rheumatoid arthritis     461255 (CXCL3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     461255 (CXCL3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     461255 (CXCL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     461255 (CXCL3) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    461255 (CXCL3) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Lenti_VIF_2 Motif Other DBs NCBI-GeneID:  461255 NCBI-ProteinID:  XP_517228 Ensembl:  ENSPTRG00000016161 VGNC:  8662 UniProt:  H2QPN9 A0A6D2WRJ0 LinkDB All DBs Position 3:56067255..56069845 Genome browser AA seq 107 aa AA seqDB search MARATLSTAPSNPRLLRVALLLLLLVAAGRRAAGASVVTELRCQCLQTLQGIHLKNIQSV NVKSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccacgctctccaccgcccccagcaatccccggctcctgcgggtggcgctg ctgctcctgctcctggtggccgccggccggcgcgcagcaggagcgtccgtggtcactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg aatgtgaagtccccaggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggaagaaagcttgtctcaacccggcatcccccatggttcagaaaatcatcgaaaagata ctgaacaaggggagcaccaactga

DBGET integrated database retrieval system