Pan troglodytes (chimpanzee): 466665 Help Entry 466665            CDS       T01005                                  Symbol RELA Name (RefSeq) transcription factor P65   KO K04735   transcription factor p65 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01523   Antifolate resistance ptr04010   MAPK signaling pathway ptr04014   Ras signaling pathway ptr04024   cAMP signaling pathway ptr04062   Chemokine signaling pathway ptr04064   NF-kappa B signaling pathway ptr04066   HIF-1 signaling pathway ptr04071   Sphingolipid signaling pathway ptr04137   Mitophagy - animal ptr04151   PI3K-Akt signaling pathway ptr04210   Apoptosis ptr04211   Longevity regulating pathway ptr04218   Cellular senescence ptr04380   Osteoclast differentiation ptr04613   Neutrophil extracellular trap formation ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04625   C-type lectin receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04659   Th17 cell differentiation ptr04660   T cell receptor signaling pathway ptr04662   B cell receptor signaling pathway ptr04668   TNF signaling pathway ptr04722   Neurotrophin signaling pathway ptr04917   Prolactin signaling pathway ptr04920   Adipocytokine signaling pathway ptr04926   Relaxin signaling pathway ptr04931   Insulin resistance ptr04932   Non-alcoholic fatty liver disease ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr04936   Alcoholic liver disease ptr05010   Alzheimer disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05030   Cocaine addiction ptr05132   Salmonella infection ptr05133   Pertussis ptr05134   Legionellosis ptr05135   Yersinia infection ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05145   Toxoplasmosis ptr05146   Amoebiasis ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05166   Human T-cell leukemia virus 1 infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05202   Transcriptional misregulation in cancer ptr05203   Viral carcinogenesis ptr05207   Chemical carcinogenesis - receptor activation ptr05208   Chemical carcinogenesis - reactive oxygen species ptr05212   Pancreatic cancer ptr05215   Prostate cancer ptr05220   Chronic myeloid leukemia ptr05221   Acute myeloid leukemia ptr05222   Small cell lung cancer ptr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptr05321   Inflammatory bowel disease ptr05415   Diabetic cardiomyopathy ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     466665 (RELA)    04014 Ras signaling pathway     466665 (RELA)    04064 NF-kappa B signaling pathway     466665 (RELA)    04668 TNF signaling pathway     466665 (RELA)    04066 HIF-1 signaling pathway     466665 (RELA)    04071 Sphingolipid signaling pathway     466665 (RELA)    04024 cAMP signaling pathway     466665 (RELA)    04151 PI3K-Akt signaling pathway     466665 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     466665 (RELA)   09143 Cell growth and death    04210 Apoptosis     466665 (RELA)    04218 Cellular senescence     466665 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     466665 (RELA)    04620 Toll-like receptor signaling pathway     466665 (RELA)    04621 NOD-like receptor signaling pathway     466665 (RELA)    04622 RIG-I-like receptor signaling pathway     466665 (RELA)    04623 Cytosolic DNA-sensing pathway     466665 (RELA)    04625 C-type lectin receptor signaling pathway     466665 (RELA)    04660 T cell receptor signaling pathway     466665 (RELA)    04658 Th1 and Th2 cell differentiation     466665 (RELA)    04659 Th17 cell differentiation     466665 (RELA)    04657 IL-17 signaling pathway     466665 (RELA)    04662 B cell receptor signaling pathway     466665 (RELA)    04062 Chemokine signaling pathway     466665 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     466665 (RELA)    04917 Prolactin signaling pathway     466665 (RELA)    04926 Relaxin signaling pathway     466665 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     466665 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     466665 (RELA)   09149 Aging    04211 Longevity regulating pathway     466665 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     466665 (RELA)    05202 Transcriptional misregulation in cancer     466665 (RELA)    05207 Chemical carcinogenesis - receptor activation     466665 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     466665 (RELA)    05203 Viral carcinogenesis     466665 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     466665 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     466665 (RELA)    05221 Acute myeloid leukemia     466665 (RELA)    05220 Chronic myeloid leukemia     466665 (RELA)    05215 Prostate cancer     466665 (RELA)    05222 Small cell lung cancer     466665 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     466665 (RELA)    05170 Human immunodeficiency virus 1 infection     466665 (RELA)    05161 Hepatitis B     466665 (RELA)    05160 Hepatitis C     466665 (RELA)    05171 Coronavirus disease - COVID-19     466665 (RELA)    05164 Influenza A     466665 (RELA)    05162 Measles     466665 (RELA)    05168 Herpes simplex virus 1 infection     466665 (RELA)    05163 Human cytomegalovirus infection     466665 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     466665 (RELA)    05169 Epstein-Barr virus infection     466665 (RELA)    05165 Human papillomavirus infection     466665 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     466665 (RELA)    05135 Yersinia infection     466665 (RELA)    05133 Pertussis     466665 (RELA)    05134 Legionellosis     466665 (RELA)    05152 Tuberculosis     466665 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     466665 (RELA)    05145 Toxoplasmosis     466665 (RELA)    05140 Leishmaniasis     466665 (RELA)    05142 Chagas disease     466665 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     466665 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     466665 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     466665 (RELA)   09165 Substance dependence    05030 Cocaine addiction     466665 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     466665 (RELA)    05418 Fluid shear stress and atherosclerosis     466665 (RELA)    05415 Diabetic cardiomyopathy     466665 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     466665 (RELA)    04932 Non-alcoholic fatty liver disease     466665 (RELA)    04931 Insulin resistance     466665 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     466665 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     466665 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ptr03000]     466665 (RELA) Transcription factors [BR:ptr03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     466665 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  466665 NCBI-ProteinID:  NP_001233559 Ensembl:  ENSPTRG00000003889 VGNC:  10283 UniProt:  A0A6D2WC88 G2HHW9 LinkDB All DBs Position 9:complement(67978023..67987421) Genome browser AA seq 551 aa AA seqDB search MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVREPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc atcaagatcaatggctacacaggaccagggacagtgcgcatctccctggtcaccaaggac cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc ttccaggtgacagtgcgggaaccatcaggcaggcccctccgcctgccgcctgtcctttct catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg caagctgacgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat gatgagtttcccaccatggtgtttccttccgggcagatcagccaggcctcggccttggcc ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca gctgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system