Pan troglodytes (chimpanzee): 473183 Help Entry 473183            CDS       T01005                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04151   PI3K-Akt signaling pathway ptr04217   Necroptosis ptr04380   Osteoclast differentiation ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04630   JAK-STAT signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04668   TNF signaling pathway ptr04936   Alcoholic liver disease ptr05135   Yersinia infection ptr05142   Chagas disease ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     473183 (IFNB1)    04668 TNF signaling pathway     473183 (IFNB1)    04151 PI3K-Akt signaling pathway     473183 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     473183 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     473183 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     473183 (IFNB1)    04621 NOD-like receptor signaling pathway     473183 (IFNB1)    04622 RIG-I-like receptor signaling pathway     473183 (IFNB1)    04623 Cytosolic DNA-sensing pathway     473183 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     473183 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     473183 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     473183 (IFNB1)    05161 Hepatitis B     473183 (IFNB1)    05160 Hepatitis C     473183 (IFNB1)    05171 Coronavirus disease - COVID-19     473183 (IFNB1)    05164 Influenza A     473183 (IFNB1)    05162 Measles     473183 (IFNB1)    05168 Herpes simplex virus 1 infection     473183 (IFNB1)    05163 Human cytomegalovirus infection     473183 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     473183 (IFNB1)    05169 Epstein-Barr virus infection     473183 (IFNB1)    05165 Human papillomavirus infection     473183 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     473183 (IFNB1)    05152 Tuberculosis     473183 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     473183 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     473183 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     473183 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     473183 (IFNB1) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interferons    473183 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Forkhead Ribosomal_S15 Motif Other DBs NCBI-GeneID:  473183 NCBI-ProteinID:  XP_054513955 Ensembl:  ENSPTRG00000020811 VGNC:  8900 UniProt:  H2QX22 LinkDB All DBs Position 11:94831661..94835137 Genome browser AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNIQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVKNLLANVYHQINHLK TVLEEKPEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LAGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt tccatgagctacaacttgcttggattcctacaaagaagcagcaatattcagtgtcagaag ctcctgtggcaattgaatgggaggcttgaatattgcctcaaggacaggatgaactttgac atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg aatgagactattgttaagaacctcctggctaatgtctatcatcagataaaccatctgaag acagtcctggaagaaaaaccggagaaagaagatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatattatgggagaattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga cttgcaggttacctccgaaactga

DBGET integrated database retrieval system