Pan troglodytes (chimpanzee): 494186 Help Entry 494186            CDS       T01005                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01523   Antifolate resistance ptr04010   MAPK signaling pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04064   NF-kappa B signaling pathway ptr04071   Sphingolipid signaling pathway ptr04150   mTOR signaling pathway ptr04210   Apoptosis ptr04217   Necroptosis ptr04350   TGF-beta signaling pathway ptr04380   Osteoclast differentiation ptr04612   Antigen processing and presentation ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04625   C-type lectin receptor signaling pathway ptr04640   Hematopoietic cell lineage ptr04650   Natural killer cell mediated cytotoxicity ptr04657   IL-17 signaling pathway ptr04660   T cell receptor signaling pathway ptr04664   Fc epsilon RI signaling pathway ptr04668   TNF signaling pathway ptr04920   Adipocytokine signaling pathway ptr04930   Type II diabetes mellitus ptr04931   Insulin resistance ptr04932   Non-alcoholic fatty liver disease ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr04936   Alcoholic liver disease ptr04940   Type I diabetes mellitus ptr05010   Alzheimer disease ptr05014   Amyotrophic lateral sclerosis ptr05020   Prion disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05132   Salmonella infection ptr05133   Pertussis ptr05134   Legionellosis ptr05135   Yersinia infection ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05143   African trypanosomiasis ptr05144   Malaria ptr05145   Toxoplasmosis ptr05146   Amoebiasis ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05166   Human T-cell leukemia virus 1 infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05205   Proteoglycans in cancer ptr05310   Asthma ptr05321   Inflammatory bowel disease ptr05322   Systemic lupus erythematosus ptr05323   Rheumatoid arthritis ptr05330   Allograft rejection ptr05332   Graft-versus-host disease ptr05410   Hypertrophic cardiomyopathy ptr05414   Dilated cardiomyopathy ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     494186 (TNF)    04350 TGF-beta signaling pathway     494186 (TNF)    04064 NF-kappa B signaling pathway     494186 (TNF)    04668 TNF signaling pathway     494186 (TNF)    04071 Sphingolipid signaling pathway     494186 (TNF)    04150 mTOR signaling pathway     494186 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     494186 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     494186 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     494186 (TNF)    04217 Necroptosis     494186 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     494186 (TNF)    04620 Toll-like receptor signaling pathway     494186 (TNF)    04621 NOD-like receptor signaling pathway     494186 (TNF)    04622 RIG-I-like receptor signaling pathway     494186 (TNF)    04625 C-type lectin receptor signaling pathway     494186 (TNF)    04650 Natural killer cell mediated cytotoxicity     494186 (TNF)    04612 Antigen processing and presentation     494186 (TNF)    04660 T cell receptor signaling pathway     494186 (TNF)    04657 IL-17 signaling pathway     494186 (TNF)    04664 Fc epsilon RI signaling pathway     494186 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     494186 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     494186 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     494186 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     494186 (TNF)    05170 Human immunodeficiency virus 1 infection     494186 (TNF)    05161 Hepatitis B     494186 (TNF)    05160 Hepatitis C     494186 (TNF)    05171 Coronavirus disease - COVID-19     494186 (TNF)    05164 Influenza A     494186 (TNF)    05168 Herpes simplex virus 1 infection     494186 (TNF)    05163 Human cytomegalovirus infection     494186 (TNF)    05169 Epstein-Barr virus infection     494186 (TNF)    05165 Human papillomavirus infection     494186 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     494186 (TNF)    05135 Yersinia infection     494186 (TNF)    05133 Pertussis     494186 (TNF)    05134 Legionellosis     494186 (TNF)    05152 Tuberculosis     494186 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     494186 (TNF)    05144 Malaria     494186 (TNF)    05145 Toxoplasmosis     494186 (TNF)    05140 Leishmaniasis     494186 (TNF)    05142 Chagas disease     494186 (TNF)    05143 African trypanosomiasis     494186 (TNF)   09163 Immune disease    05310 Asthma     494186 (TNF)    05322 Systemic lupus erythematosus     494186 (TNF)    05323 Rheumatoid arthritis     494186 (TNF)    05321 Inflammatory bowel disease     494186 (TNF)    05330 Allograft rejection     494186 (TNF)    05332 Graft-versus-host disease     494186 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     494186 (TNF)    05014 Amyotrophic lateral sclerosis     494186 (TNF)    05020 Prion disease     494186 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     494186 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     494186 (TNF)    05418 Fluid shear stress and atherosclerosis     494186 (TNF)    05410 Hypertrophic cardiomyopathy     494186 (TNF)    05414 Dilated cardiomyopathy     494186 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     494186 (TNF)    04940 Type I diabetes mellitus     494186 (TNF)    04936 Alcoholic liver disease     494186 (TNF)    04932 Non-alcoholic fatty liver disease     494186 (TNF)    04931 Insulin resistance     494186 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     494186 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     494186 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     494186 (TNF)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     494186 (TNF) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Tumor necrosis fators    494186 (TNF) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Cytokines    494186 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  494186 NCBI-ProteinID:  NP_001038976 Ensembl:  ENSPTRG00000017965 UniProt:  Q8HZD9 LinkDB All DBs Position 5:37372673..37375469 Genome browser AA seq 232 aa AA seqDB search MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAGSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRD NQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRET PEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg gaagagttccccagggacctctctctaatcagccctctggcccaggcaggatcatcttct cgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgaggggcag ctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgagagat aaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttcaag ggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgccgtc tcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggagacc ccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttccag ctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgactttgcc gagtctggacaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system