Pan troglodytes (chimpanzee): 739011 Help Entry 739011            CDS       T01005                                  Symbol IL18 Name (RefSeq) interleukin-18 isoform X1   KO K05482   interleukin 18 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04621   NOD-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr05132   Salmonella infection ptr05134   Legionellosis ptr05135   Yersinia infection ptr05143   African trypanosomiasis ptr05144   Malaria ptr05152   Tuberculosis ptr05164   Influenza A ptr05321   Inflammatory bowel disease ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     739011 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     739011 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     739011 (IL18)    04623 Cytosolic DNA-sensing pathway     739011 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     739011 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     739011 (IL18)    05135 Yersinia infection     739011 (IL18)    05134 Legionellosis     739011 (IL18)    05152 Tuberculosis     739011 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     739011 (IL18)    05143 African trypanosomiasis     739011 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     739011 (IL18)    05321 Inflammatory bowel disease     739011 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     739011 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     739011 (IL18) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interleukins    739011 (IL18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  739011 NCBI-ProteinID:  XP_001146844 Ensembl:  ENSPTRG00000004284 VGNC:  1069 UniProt:  A0A6D2WDP8 A0A2J8L0A3 LinkDB All DBs Position 9:complement(114125807..114146931) Genome browser AA seq 193 aa AA seqDB search MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL GDRSIMFTVQNED NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac aatacgctttactttatagctgaagatgatgaaaacctggaatcagattactttggcaag ctcgaatctaaattatcagtcataagaaatttgaatgaccaagttctcttcattgaccaa ggaaatcggcctctatttgaagatatgactgattctgactgtagagataatgcaccccgg accatatttattataagtatgtataaagatagccagcctagaggtatggctgtaactatc tctgtgaagtgtgagaaaatttcaactctctcctgtgagaacaaaattatttcctttaag gaaatgaatcctcctgataacatcaaggatacaaaaagtgacatcatattctttcagaga agtgtcccaggacatgataataagatgcaatttgaatcttcatcatatgaaggatacttt ctagcttgtgaaaaagagagagacctttttaaactcattttgaaaaaagaggatgaattg ggggatagatctataatgttcactgttcaaaatgaagactag

DBGET integrated database retrieval system