Pan troglodytes (chimpanzee): 739125 Help Entry 739125            CDS       T01005                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr00510   N-Glycan biosynthesis ptr00513   Various types of N-glycan biosynthesis ptr04141   Protein processing in endoplasmic reticulum Module ptr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ptr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     739125 (TMEM258)    00513 Various types of N-glycan biosynthesis     739125 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     739125 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  739125 NCBI-ProteinID:  XP_003951956 Ensembl:  ENSPTRG00000003750 VGNC:  969 UniProt:  A0A6D2VTU6 H2Q3U6 LinkDB All DBs Position 9:complement(64039571..64043088) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatataccagcccagtgaacccagctgtcttcccccat ctgactgtggtgcttttggccatcggcatgttcttcaccgcctggttcttcgtttacgag gtcacctctaccaagtacactcgtgatatctataaagagctcctcatctccttagtggcc tcactcttcatgggctttggagtcctcttcctgctgctctgggttggcatctacgtgtga

DBGET integrated database retrieval system