Pan troglodytes (chimpanzee): 740567 Help Entry 740567            CDS       T01005                                  Symbol CXCL1 Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04064   NF-kappa B signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04668   TNF signaling pathway ptr04936   Alcoholic liver disease ptr05134   Legionellosis ptr05146   Amoebiasis ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     740567 (CXCL1)    04668 TNF signaling pathway     740567 (CXCL1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     740567 (CXCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     740567 (CXCL1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     740567 (CXCL1)    04657 IL-17 signaling pathway     740567 (CXCL1)    04062 Chemokine signaling pathway     740567 (CXCL1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     740567 (CXCL1)   09171 Infectious disease: bacterial    05134 Legionellosis     740567 (CXCL1)   09174 Infectious disease: parasitic    05146 Amoebiasis     740567 (CXCL1)   09163 Immune disease    05323 Rheumatoid arthritis     740567 (CXCL1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     740567 (CXCL1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     740567 (CXCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     740567 (CXCL1) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    740567 (CXCL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  740567 NCBI-ProteinID:  XP_001156094 Ensembl:  ENSPTRG00000016157 VGNC:  8658 UniProt:  H2QPN5 A0A6D2XEA6 LinkDB All DBs Position 3:complement(56240127..56241913) Genome browser AA seq 107 aa AA seqDB search MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgctctctccgccgcccccagcaatccccggctcctgcgagtggcactg ctgctcctgctcctggtagccgccggccggcgcgcagcaggagcgtccgtggccactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggcggaaagcttgccttaatcccgcatcccccatagttaagaaaatcatcgaaaagatg ctgaacagtgacaaatccaactga

DBGET integrated database retrieval system