Pan troglodytes (chimpanzee): 742818 Help Entry 742818            CDS       T01005                                  Symbol CD209L2 Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03260   Virion - Human immunodeficiency virus ptr03264   Virion - Flavivirus and Alphavirus ptr03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus ptr03273   Virion - Lassa virus and SFTS virus ptr04145   Phagocytosis ptr04517   IgSF CAM signaling ptr04625   C-type lectin receptor signaling pathway ptr05152   Tuberculosis ptr05162   Measles Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     742818 (CD209L2)    03264 Virion - Flavivirus and Alphavirus     742818 (CD209L2)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     742818 (CD209L2)    03273 Virion - Lassa virus and SFTS virus     742818 (CD209L2)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     742818 (CD209L2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     742818 (CD209L2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     742818 (CD209L2)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     742818 (CD209L2)   09171 Infectious disease: bacterial    05152 Tuberculosis     742818 (CD209L2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     742818 (CD209L2)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:ptr04054]     742818 (CD209L2)    04515 Cell adhesion molecules [BR:ptr04515]     742818 (CD209L2)    04090 CD molecules [BR:ptr04090]     742818 (CD209L2)    04091 Lectins [BR:ptr04091]     742818 (CD209L2) Membrane trafficking [BR:ptr04131]  Endocytosis   Phagocytosis    C-lectin receptors     742818 (CD209L2) Pattern recognition receptors [BR:ptr04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    742818 (CD209L2) Cell adhesion molecules [BR:ptr04515]  Lectins   Selectins and C-type lectins    742818 (CD209L2) CD molecules [BR:ptr04090]  Proteins   742818 (CD209L2) Lectins [BR:ptr04091]  C-Type lectins   Asialoglycoprotein and DC receptors    742818 (CD209L2) SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Swm2 DUF4153 BRICHOS Methyltransf_FA SieB Motif Other DBs NCBI-GeneID:  742818 NCBI-ProteinID:  NP_001123945 Ensembl:  ENSPTRG00000039006 UniProt:  B2BSM7 LinkDB All DBs Position 20:complement(10141953..10152400) Genome browser AA seq 256 aa AA seqDB search MSDSKEPRLQLLGLLEEEELITSGMNFFPRNFGFRQTRGYKSLAGRLSHAPLVLLLLFFT LFTGLLVAILVQGSKNPSSQRQEQSKQEEIFQDLSQLKAAVERLCRRCPWEWTFFQGNCY FMSNSQRNWHDSITACQEVGAQLVVIKSAEEQNFLQLQSSKSNPLAWMGLSDLNQEGTWQ WVDGSPLSSSFKQYWNRGEPNNIREEDCVEFNGNGWNDDKCSVAKFWICKMSAASCSRDE GRLLPSASVSPTAHAA NT seq 771 nt NT seq  +upstreamnt  +downstreamnt atgagtgactccaaggaaccaagggtgcagctgctgggcctcctggaagaggaagagctg ataactagcggtatgaattttttcccgagaaactttggattccgacagactcgaggctac aagagcttagcagggcgtctgagccacgcgcccctggtgctgctgctcctcttcttcaca ctcttcactgggctcctggtggccatccttgtccaaggttccaagaaccccagctcccag aggcaggagcagtccaagcaggaggagatcttccaggacctgtcccagctgaaggctgca gtggaacgcctgtgccgccgctgcccctgggaatggacattcttccaaggtaactgttac ttcatgtctaactcccagcggaactggcacgactccatcactgcctgccaagaagtgggg gcccagctcgtcgtaatcaaaagtgctgaggagcagaacttcttacagctgcagtcttcc aaaagtaaccccttagcttggatgggactttcagatctaaatcaggaaggcacgtggcaa tgggtggacggctcacctctgtcatccagcttcaagcagtattggaacagaggagagcct aacaatatcagggaggaagactgtgtggaatttaacggcaatggctggaatgacgacaaa tgcagtgttgccaaattctggatctgcaaaatgtctgcagcctcctgctccagagatgaa gggcggcttctcccctcagcctctgtatccccgactgcccatgcagcatag

DBGET integrated database retrieval system