Pan troglodytes (chimpanzee): 746570 Help Entry 746570            CDS       T01005                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03082   ATP-dependent chromatin remodeling ptr04015   Rap1 signaling pathway ptr04145   Phagosome ptr04210   Apoptosis ptr04390   Hippo signaling pathway ptr04510   Focal adhesion ptr04520   Adherens junction ptr04530   Tight junction ptr04611   Platelet activation ptr04613   Neutrophil extracellular trap formation ptr04670   Leukocyte transendothelial migration ptr04714   Thermogenesis ptr04810   Regulation of actin cytoskeleton ptr04814   Motor proteins ptr04820   Cytoskeleton in muscle cells ptr04919   Thyroid hormone signaling pathway ptr04921   Oxytocin signaling pathway ptr04971   Gastric acid secretion ptr05014   Amyotrophic lateral sclerosis ptr05100   Bacterial invasion of epithelial cells ptr05132   Salmonella infection ptr05135   Yersinia infection ptr05164   Influenza A ptr05205   Proteoglycans in cancer ptr05225   Hepatocellular carcinoma ptr05410   Hypertrophic cardiomyopathy ptr05412   Arrhythmogenic right ventricular cardiomyopathy ptr05414   Dilated cardiomyopathy ptr05416   Viral myocarditis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     746570 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     746570 (ACTG1)    04390 Hippo signaling pathway     746570 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     746570 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     746570 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     746570 (ACTG1)    04520 Adherens junction     746570 (ACTG1)    04530 Tight junction     746570 (ACTG1)   09142 Cell motility    04814 Motor proteins     746570 (ACTG1)    04820 Cytoskeleton in muscle cells     746570 (ACTG1)    04810 Regulation of actin cytoskeleton     746570 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     746570 (ACTG1)    04613 Neutrophil extracellular trap formation     746570 (ACTG1)    04670 Leukocyte transendothelial migration     746570 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     746570 (ACTG1)    04919 Thyroid hormone signaling pathway     746570 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     746570 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     746570 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     746570 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     746570 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     746570 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     746570 (ACTG1)    05135 Yersinia infection     746570 (ACTG1)    05100 Bacterial invasion of epithelial cells     746570 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     746570 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     746570 (ACTG1)    05410 Hypertrophic cardiomyopathy     746570 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     746570 (ACTG1)    05414 Dilated cardiomyopathy     746570 (ACTG1)    05416 Viral myocarditis     746570 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ptr03021]     746570 (ACTG1)    03019 Messenger RNA biogenesis [BR:ptr03019]     746570 (ACTG1)    03036 Chromosome and associated proteins [BR:ptr03036]     746570 (ACTG1)    03029 Mitochondrial biogenesis [BR:ptr03029]     746570 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptr04812]     746570 (ACTG1)    04147 Exosome [BR:ptr04147]     746570 (ACTG1) Transcription machinery [BR:ptr03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      746570 (ACTG1) Messenger RNA biogenesis [BR:ptr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      746570 (ACTG1) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      746570 (ACTG1)     NuA4 complex      746570 (ACTG1)   Chromatin remodeling factors    BAF complex     746570 (ACTG1)    PBAF complex     746570 (ACTG1)    GBAF(ncBAF) complex     746570 (ACTG1)    SWR1 complex     746570 (ACTG1) Mitochondrial biogenesis [BR:ptr03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     746570 (ACTG1) Cytoskeleton proteins [BR:ptr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      746570 (ACTG1) Exosome [BR:ptr04147]  Exosomal proteins   Proteins found in most exosomes    746570 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  746570 NCBI-ProteinID:  NP_001128241 Ensembl:  ENSPTRG00000048969 VGNC:  58847 UniProt:  A5A6N1 LinkDB All DBs Position 19:complement(94914240..94917207) Genome browser AA seq 381 aa AA seqDB search MEDEISALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAMIKRDG RGHSYCAARGEILGPAQDGPERKHLPRMFSLIKNVFIVMDSGDGVTHTVPIYEGYALPHA ILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS SLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLY ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ MWISKQEYDESGPSIVHRKCF NT seq 1127 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagatcgccgcgctggtcattgacaatggctccggcatgtgcaaagctggt tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgccccagacac cagggcgtgatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc aagcgtggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggccccggaggag cacccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact caggtgaggctcggccgacgcccgtgctcctcccgtcctttccccagtcattttctgccc ggcttgatttctgacatttaagtgtttgcattgtcatggactctggagacggggtcaccc acacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctgg ctggccgggacctgaccgactacctcatgaagatcctcaccgagcgaggctacagcttca ccaccacggccgagcgggaaatcgtgcgcgacatcaaggagaagctgtgctacgtcgccc tggacttcgagcaggagatggccaccgccgcatcttcctcttctctggagaagagctacg agctgcctgatggccaggtcatcaccatcggcaatgagcggttccggtgtccggaggcgc tgttccagccttccttcctgggcatggaatcttgcggcatccacgagaccaccttcaact ccatcatgaagtgtgacgtggacatccgcaaagacctgtatgccaacacggtgctgtcgg gcggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcaccgccctgg cgcccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcggtgtgga tcggcggctccatcctggcctcgctgtccaccttccagcagatgtggattagcaagcagg agtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system