KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117027770
Entry
117027770         CDS       T07722                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq00250  Alanine, aspartate and glutamate metabolism
rfq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    117027770 (RIMKLA)
Enzymes [BR:rfq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     117027770 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     117027770 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 117027770
NCBI-ProteinID: XP_032971768
Ensembl: ENSRFEG00010005649
LinkDB
Position
9:29845061..29871553
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTFPDVVLVRVSTPSMQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHQGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYAM
SLLPSRQTGKMAVLPGLSSPREKKEPDGCASAQGVTESIYTINSGSTSSESEPELGEIRD
SSASTAGPPAPKLPEPSYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgtgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggccacctcggcctgcagctgaaccag
aaggcactcaccactttcccggatgtggtacttgttcgggtgtccacaccctcaatgcaa
tcggacagtgacatcacagtcctgcgacacctggagaagttgggctgtcgcttagtcaac
cgcccacagagcattttaaactgcatcaacaaattctggacattccaagagctggctgga
cacggggtccccatgccagacaccttctcctatggtgggcatgaagacttttccaaaatg
attgatgaagcggagcccctgggctacccggtcgtggtgaagagcacacgaggacaccag
ggaaaagctgtttttcttgcaagagataaacatcacctctcagacatttgccatctgatc
cgccatgatgtgccctacctgttccagaagtatgtgaaggagtcacatggaaaagatatc
cgggtggtggtggtcgggggccaggtgataggctctatgcttcgctgctccaccgacgga
cgcatgcagagcaactgctccctcggtggtgtgggcgtcatgtgcccgctgacagaacaa
ggcaagcagctggctattcaggtgtccaacatcctgggcatggacttctgtggcattgac
ctcctcatcatggacgatggctcctttgtggtgtgtgaggcaaatgccaacgtcggtttc
ctcgccttcgaccaggcatgcaacttagacgtgggtgggatcattgcagactacgccatg
tccttgctgccaagtaggcagactgggaagatggctgtcctcccgggactgtctagtccc
agggagaagaaagagccagatggctgtgcttcagctcagggagttacagagagcatctac
accatcaacagtgggtctacctctagtgagagtgagcctgaactgggagaaatacgggat
tcctcagcaagcacagcggggcccccagcccccaagctgcccgaacccagctacaacatt
aacaacaggattgcttctgaattaaaactgaagtga

DBGET integrated database retrieval system