KEGG   Rattus norvegicus (rat): 116569
Entry
116569            CDS       T01003                                 
Symbol
Lct
Name
(RefSeq) lactase-phlorizin hydrolase preproprotein
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno01100  Metabolic pathways
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    116569 (Lct)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    116569 (Lct)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    116569 (Lct)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     116569 (Lct)
    3.2.1.108  lactase
     116569 (Lct)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Others
   116569 (Lct)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 116569
NCBI-ProteinID: NP_446293
RGD: 620823
Ensembl: ENSRNOG00000003681
UniProt: A9CMC8
LinkDB
Position
13:complement(39781929..39824456)
AA seq 1929 aa
MELPWTALFLSTVLLGLSCQGSDWESDRNFISAAGPLTNDLVLNLNYPPGKQGSDVVSGN
TDIYICQQPLPSFLSQYFSSLRASQVTHYKVLLSWAQLLPTGSSKNPDQEAVQCYRQLLQ
SLKDAQLEPMVVLCHQTPPTSSAIQREGAFADLFADYATLAFQSFGDLVEIWFTFSDLEK
VIMDLPHKDLKASALQTLSNAHRRAFDIYHRKFSSQGGKLSVVLKAEDIPELLPDPALAA
LVQGSVDFLSLDLSYECQSVATLPQKLSELQNLEPKVKVFIYTLKLEDCPATGTSPSSLL
ISLLEAINKDQIQTVGFDVNAFLSCTSNSEESPSCSLTDSLALQTEQQQETAVPSSPGSA
YQRVWAAFANQSREERDAFLQDVFPEGFLWGISTGAFNVEGGWAEGGRGPSIWDHYGNLN
AAEGQATAKVASDSYHKPASDVALLRGIRAQVYKFSISWSRLFPTGQKSTPNRQGVAYYN
KLIDRLLDSHIEPMATLFHWDLPQALQEQGGWQNESVVEAFLDYAAFCFSTFGDRVKLWV
TFHEPWVMSYAGYGTGQHAPAISDPGMASFKVAHLILKAHARTWHLYDLHHRLQQQGRVG
IVLNSDWAEPLDRKSPQDLAAAERFLHFMLGWFAHPIFVDGDYPTTLRAQIQHINQQCGH
PLAQLPEFTEAEKRLLKGSADFLGLSHYTSRLISKAGRQTCTSSYDNIGGFSQHVDPEWP
QTASPWIRVVPWGIRRLLRFASMEYTKGKLPIFLAGNGMPVGEEADLFDDSVRVNYFNLY
INEVLKAVKEDLVDVRSYIVRSLIDGYEGPLGFSQRFGLYHVNFNDSSRPRTPRKSAYFF
TSIIEKNGFSAKKVKRNPLPVRADFTSRARVTDSLPSEVPSKAKIVWEKFSKQPRFERDL
FYHGTFRDDFLWGVSSSAYQIEGGWNADGKGPSIWDNFTHTPGNGVKDNATGDVACDSYH
QLDADLNILRTLKVKSYRFSISWSRIFPTGRNSTINKQGVDYYNRLIDSLVDNNIFPMVT
LFHWDLPQALQDIGGWENPSLIELFDSYADFCFKTFGDRVKFWMTFNEPWCHVVLGYSSG
IFPPSVQEPGWLPYKVSHIVIKAHARVYHTYDEKYRSEQKGVISLSLNTHWAEPKDPGLQ
RDVEAADRMLQFTMGWFAHPIFKNGDYPDVMKWTVGNRSELQHLASSRLPTFTEEEKNYV
RGTADVFCINTYTSVFVQHSTPRLNPPSYDDDMELKLIEMNSSTGVMHPDVPWGTRRLLN
WIKEEYGNIPIYITENGQGLENPTLDDTERIFYHKTYINEALKAYKLDGVDLRGYSAWTL
MDDFEWLLGYTMRFGLYHVDFNHVSRPRTARASARYYAEVIANNGMPLAREDEFLYGEFP
KGFIWSAASASYQVEGAWRADGKGLSIWDTFSHTPLRIGNDDNGDVACDSYHKIAEDVVA
LQNLGVSHYRFSIAWSRILPDGTTKFINEAGLSYYVRFIDALLAAGITPQVTIYHWDLPQ
ALQDVGGWENETIVQRFKEYADVLFQRLGDRVKFWITLNEPFVIAAQGYGTGVSAPGISF
RPGTAPYIAGHNLIKAHAEAWHLYNDVYRARQGGTISITISSDWAEPRDPTNQGDVEAAR
RYVQFMGGWFAHPIFKNGDYPEVMKTRIRDRSLAAGLNKSRLPEFTESEKSRIKGTFDFF
GFNHYTTVLAYNLDYPAAFSSFDADRGVASIADSSWPVSGSFWLKVTPFGFRRILNWLKE
EYNNPPIYVTENGVSRRGEPELNDTDRIYYLRSYINEALKAVQDKVDLRGYTVWSIMDNF
EWATGFAERFGVHFVNRSDPSLPRIPKASAKFYATIVRCNGFPDPAQGPHPCLQQPEDAA
PTASPVQSEVPFLGLMLGIAEAQTALYVLFALLLLGACSLAFLTYKYCRRSKQGNAQPSQ
HQLSPISSF
NT seq 5790 nt   +upstreamnt  +downstreamnt
atggagctgccttggacagcactcttcctgagtactgtcctcctgggtctttcatgccag
ggctctgactgggaatccgacagaaattttatttcagccgctggtcctctaacaaatgac
ttagtgcttaatctgaactatccaccgggaaagcagggctctgatgtggtatccggtaac
accgacatctacatctgccagcagccactgccctctttcttgtctcagtatttcagcagt
cttcgtgccagccaggttacccattacaaagttcttctgtcatgggcacaacttctccca
actggaagctccaagaatccagaccaggaagcagtgcagtgctaccgacaactcctccag
tccctgaaggatgcccagcttgagcccatggtggtcctgtgccatcagacgccacccacc
agcagcgccatccagagagaaggggcctttgctgacctctttgctgactatgccacattg
gcttttcagtcctttggggaccttgttgagatctggttcaccttcagtgacttggagaaa
gtgatcatggatcttccccacaaagatctgaaagcttctgctcttcaaaccctcagcaat
gcccacaggagagcctttgacatttaccacagaaagttctcatctcaggggggaaagctg
tctgtggtcctgaaggctgaagatattccagagcttctgccagacccggcattggctgct
ctcgtccagggctcggtggatttcctctctcttgatttgtcttacgaatgccaaagtgtg
gcgactctaccacagaagctgagtgaattgcagaaccttgagccaaaagtgaaagttttc
atctacaccctaaaacttgaggactgcccagcgaccgggacgagcccctcctcactgctc
atcagcctcctggaagccataaataaagaccaaatccaaactgttggctttgatgttaat
gcattcctgagctgtacgtccaattctgaggagagcccatcttgttctttaaccgacagc
ctggcccttcagactgagcagcagcaggagacagctgtaccctcatcccctggatcagcc
taccagagagtttgggcagcctttgctaaccagtctagggaggaaagggatgctttccta
caagatgtgtttccagaagggttcctctggggcatatccacgggagcctttaatgtggag
ggaggctgggcagaaggcggcagagggccgagcatctgggatcactacggtaacctgaat
gctgccgagggacaagccacagcaaaagtggccagtgacagttaccacaaaccagcttct
gatgtcgccctcctccgaggcatcagggctcaggtgtacaagttctccatctcctggtcc
cgcctcttccccactgggcagaagagcacccccaaccgccaaggtgtcgcctactacaac
aaactgatcgaccgcctgctggactcacacatcgagcccatggctacactgttccactgg
gacctgcctcaggccctgcaggagcaaggcggctggcagaacgagagtgtggtggaggcc
ttcctggactacgcagccttctgcttctccactttcggggaccgtgtgaaactgtgggtg
accttccacgagccatgggtgatgagctatgcaggctatggtactggacagcacgcacca
gccatctctgacccaggaatggcttcctttaaggtggctcacctgatcctcaaggcacat
gccagaacttggcatctctacgaccttcaccatcgcctacagcagcaggggcgcgtgggc
atcgtcctcaattcagactgggcggagcccctggataggaagagtcctcaggaccttgct
gctgctgagcgcttcctacacttcatgctgggctggttcgcacaccccatctttgtagat
ggggactaccccactacccttcgggcccagatccagcacataaaccagcagtgtggccat
cctctggcccaactcccagagttcactgaagcggagaagcggctccttaagggctctgcg
gatttcctgggtctgtctcattacacctcccgcctcatcagcaaggctgggcggcagacc
tgcacctccagctacgataacatcggaggcttctcccagcatgtggaccccgagtggccc
cagactgcatctccctggatccgagtggtgccctggggcataaggaggctgcttcggttc
gcgtctatggagtacacgaaagggaaacttccaatcttcttggctgggaatggcatgcca
gtaggggaagaagcggacctctttgacgactcagtgagagtaaactacttcaacttgtac
atcaacgaggtgctcaaggctgtcaaggaggatttggtggatgtccgttcatacattgtt
cgttccctcattgacggctatgaaggacccctgggcttcagtcagaggtttgggctatac
catgtcaacttcaatgacagcagcaggccacgaactcccaggaaatctgcatacttcttc
accagcatcattgaaaagaatggtttttcagccaagaaagtcaaaagaaacccactgccc
gtgagagcagacttcacctccagagccagggtcaccgacagccttccatcggaggtgccc
tccaaggctaaaatagtgtgggagaagttctccaagcagcccaggtttgaaagagacttg
ttctatcacggcacattccgggatgacttcctgtggggtgtatcctcttcagcctatcag
atcgaaggaggatggaatgctgatggcaaaggccccagcatctgggataacttcacccac
accccagggaatggtgtgaaagacaatgccaccggagacgtagcgtgcgacagctatcac
caactggacgccgacctaaacatccttcgaaccctgaaggtcaagtcctatcgattttcc
atctcctggtctcgaattttcccaacaggaagaaacagtaccatcaacaaacaaggcgtt
gattattacaacagactgattgacagcttggtggacaacaacatcttccccatggtgaca
ctgtttcactgggacctgccccaggccctccaggatattggaggttgggagaacccttct
ttgattgagttgtttgacagctatgcagacttctgctttaagacctttggtgacagagtc
aagttctggatgacctttaacgagccctggtgtcacgtggtgttaggctacagttcaggg
atatttcccccaagtgttcaggagccaggctggctaccttataaggttagccatatcgtc
attaaggcacatgctagggtctaccatacttacgatgagaagtaccgctcggagcagaaa
ggtgtcatctctctcagcctcaacactcactgggcagaacccaaggacccagggctccaa
agggatgtggaagccgctgaccggatgctgcagtttaccatgggctggtttgcccacccg
atttttaaaaacggggactatccagacgtcatgaaatggactgtggggaacaggagtgag
ctgcagcacctggccagctcccgcctgcctaccttcacagaggaagagaagaattacgtc
agaggcaccgctgatgtcttttgcatcaacacctacacgtctgtgtttgtgcagcacagc
actcccaggctgaacccacccagctatgatgatgacatggagttgaagctaatcgaaatg
aactcgtcgacgggtgtgatgcacccagacgtgccctgggggacgaggaggctgctgaac
tggatcaaggaggagtatggcaacattcctatttatatcactgaaaatggacagggactg
gaaaaccccacactggatgacacagaaaggatcttctaccacaaaacctatatcaacgag
gctctgaaagcctacaagctggatggtgtggaccttcgagggtactctgcctggacgctg
atggacgacttcgagtggctgcttggctacaccatgagatttggattgtatcacgttgac
tttaatcatgtgagcagacctcgcacagcaagagcctcagccagatactatgcagaggtc
attgccaacaatggcatgcccctggccagggaagatgagttcctgtatggagagtttccc
aagggcttcatctggagtgcggcttctgcttcataccaggttgaaggcgcgtggagagca
gatggcaaaggactcagtatctgggacacattttcccacacaccactgaggatcgggaat
gatgacaacggagacgtggcatgtgacagttaccacaagattgccgaggatgtggtggcc
cttcagaacctgggcgtgtcccactatcgcttctccattgcctggtctagaatcctccca
gacggaaccaccaagttcatcaatgaagcgggcctcagttactatgttcgattcattgat
gccctgctggctgctggcatcacaccacaggtgaccatttatcactgggacctgccccag
gcactgcaagacgtggggggctgggagaacgagacaattgtgcagcggtttaaggagtac
gcggatgtgctcttccagaggctgggggacagagtcaagttctggatcactctgaacgag
cccttcgtcattgcagcccaaggctacggcactggggtgtctgctccaggaatctccttc
aggcctggcacagctccgtacattgctggacacaacctaataaaggcccacgctgaggcc
tggcatctctacaacgatgtataccgcgcccgccagggaggcaccatctccatcacgatc
agcagtgactgggctgaacccagggatcccaccaaccagggagacgtggaggcagccagg
agatacgtacagtttatggggggctggtttgctcaccccatcttcaaaaacggagattac
ccggaggtgatgaagacacggatccgcgacagaagcctggcggcaggcctcaacaagtcc
aggctccctgagtttacggagagtgagaagagtaggatcaagggcacctttgactttttc
gggttcaaccactacaccactgtcctagcttacaacctcgactacccggctgccttctcc
tcctttgatgcagacaggggcgttgcttccattgcagacagctcttggccagtctctggc
tccttctggctgaaggtgaccccttttggcttccggaggatcttgaactggctgaaggag
gagtacaataatcctccgatttatgtcaccgagaatggtgtctccagacgaggagagccg
gaactcaacgacaccgacaggatctactacctgcgcagctacattaacgaagccctcaag
gctgtacaggacaaggtggaccttcgaggctacacggtatggagcatcatggacaacttt
gaatgggccacaggcttcgcagagaggttcggtgtgcactttgtgaaccgctctgaccca
tctttgccaaggatccccaaggcatcagccaagttctatgccaccatcgtccgctgcaat
ggctttcccgaccctgcacaaggacctcatccttgtctccagcaaccagaagacgctgca
cccactgccagtcccgtgcagtcggaagtgcccttcctggggctgatgctgggcatcgca
gaagcacagacagcgctgtacgtgctcttcgctctgctgctgcttggagcctgcagcctg
gcatttctgacctacaaatactgccggcgctccaagcaagggaacgcgcagccaagccag
caccagctgagtccaatttcctccttctga

DBGET integrated database retrieval system