KEGG   Rattus norvegicus (rat): 81635
Entry
81635             CDS       T01003                                 
Symbol
Adar
Name
(RefSeq) double-stranded RNA-specific adenosine deaminase
  KO
K12968  double-stranded RNA-specific adenosine deaminase [EC:3.5.4.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05162  Measles
rno05164  Influenza A
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    81635 (Adar)
   04623 Cytosolic DNA-sensing pathway
    81635 (Adar)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    81635 (Adar)
   05164 Influenza A
    81635 (Adar)
   05162 Measles
    81635 (Adar)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    81635 (Adar)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.37  double-stranded RNA adenine deaminase
     81635 (Adar)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    81635 (Adar)
SSDB
Motif
Pfam: A_deamin z-alpha dsrm DND1_DSRM TrmB
Other DBs
NCBI-GeneID: 81635
NCBI-ProteinID: NP_112268
RGD: 71099
Ensembl: ENSRNOG00000020744
UniProt: P55266
LinkDB
Position
2:175138391..175178280
AA seq 1175 aa
MSQGFRGPTGVFPHQTQPCLDPSYEHSKWRYLQPRGSESYLRSFQLQQIEFLKGRLPEAP
LIGAQTQSLPPFLPGHWPRFPGPPAQGKQPEIWGFPRSVTLRNQGFHIGPPLPPPHSRGP
PWRGAEGLCSHFQELSISQNPEQKVLNRLEELGEGKATTAYALARELRTPKKDINRILYS
LERKGKLHRGVGKPPLWSLVPLSQACTQPPRAVNSDKEVPRGEPDLDSEDGDPASDLEGP
SELLDMAEIKEKICDYLFNVSKSSALNLAKNIGLAKARDVNAVLIDLERQGDVYREGATP
PIWYLTDKKRERLQMKRSTHSGPAATPAAVSEATQSTSFPTCHPPQSGGSSSMATSKRVE
NGQEPVTKYESRHEARPGPVRLRPHAYHNGPSRAGYVASENGPWATDDIPDNLNSIHTAP
GEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPS
HEPRFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILLREAKAKDSGQPEELSNCPME
EDPEKPAESQPPSSSATSLFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDPKFQYCV
AVGAQTFPSVSAPSKKVAKQMAAEEAMKALQEEAANSADDQSGGANTDSLDESVAPNKIR
RIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSGPPHEPKFVYQAKVGGRWFPAVCA
HSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLLLSRSPDAHPKTLP
LTGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTGNRCV
KGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNHHTAKNSIFELARGGEKLQIKKT
VSFHLYISTAPCGDGAHFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENGEGTIPVE
SSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLGYLFSQG
HLTRAICCRVTRDGNAFEDGLRYPFIVNHPKVGRVSVYDSKRQSGKTKETSVNWCLADGY
DLEILDGTRGTVDGPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAARDYDL
AKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgtctcaggggttcaggggacccacaggggtgttccctcaccagacacagccctgcttg
gaccctagctatgagcacagcaagtggagatacctgcagccacgtgggtcggagtcttac
cttaggagtttccagctccagcagatagagtttctcaaagggcggctcccagaagcaccc
ttgattggagcacagacccagtcactaccgccattcctcccaggacactggccaaggttc
ccagggccacctgcccaaggaaaacaaccggaaatctgggggtttcccaggagtgtgact
ctcagaaatcaggggttccatataggacccccacttcctcctccacacagcaggggtccg
ccatggagaggtgctgaaggtctttgctcacacttccaggagctgagcatcagtcagaat
ccagagcagaaggtcctaaaccgcctggaagagcttggtgaggggaaggccaccactgcc
tacgcgctagccagagagctcaggacccccaaaaaggacatcaatcgtatattgtactcc
ttagaaaggaagggaaaactgcatagaggagtggggaagcctcctttgtggagccttgtg
cccttaagtcaggcttgcactcagccccctagagctgtgaattcagacaaggaagtccct
cgaggagagcccgatttggacagtgaggacggagaccctgcctctgacttagaaggacct
tctgagcttcttgatatggctgaaattaaggagaaaatctgtgactatctgttcaatgtg
tcaaagtcctctgccctgaacctggctaagaacattggcctcgccaaggcccgagatgtg
aatgcagtgttgattgacttagaaaggcaaggcgatgtctacagggaaggggccactcct
cccatctggtacttgacggacaagaagcgtgagaggctgcagatgaagagaagtacacac
agtggtcctgcagctaccccagcagctgtctcagaagccactcaaagcacctcattccct
acctgccacccaccccaatcaggtggctcaagcagcatggcaacctccaaaagagtggaa
aacgggcaggagcctgtgacaaagtatgaaagtaggcacgaggcccgaccaggaccagta
cgactgcggcctcatgcttatcacaacggcccctctagagcagggtatgttgcctctgaa
aatggcccgtgggccacagatgacatcccagataacttgaatagtatccacacagcacca
ggtgagtttcgagccatcatggagatgccctccttctacagccctaccttgccacggtgt
tcaccctacaagaagctaactgagtgccagctgaagaaccctgtcagcgggttgttagag
tatgctcagttcactagtcagacctgtgatttcaacctgatagagcagagtggaccgtcc
catgaacctcgatttaaattccaggttgtcatcaatggtcgagagtttcccccagctgag
gctggcagcaagaaagttgctaagcaggacgcagcagtgaaagccatggcgattctgctt
cgggaagccaaagccaaagacagtggacagccagaagaattgtccaactgtcccatggag
gaagacccagagaagccagcagagtcccagccccccagctcctcagcaacatccttgttc
tctgggaagagcccagttactacactgcttgagtgtatgcacaagctagggaactcctgt
gaatttcgtctcctgtccaaagaaggccctgctcatgaccccaagttccagtactgtgtg
gcagtaggagcccagactttcccctctgtgagtgcccccagcaagaaagtagcaaagcag
atggccgcagaggaagccatgaaagctctgcaagaggaggcggccaattccgctgatgac
cagtctggaggtgcgaacacagactcacttgatgaatctgtggctcccaacaagatccgg
aggatcggtgagctcgtaaggtacctgaacaccaaccctgtgggtggcttgttggagtac
gcccgctctcatggctttgctgctgagttcaagctcattgaccagtctggacctcctcat
gaacccaagtttgtttaccaagcaaaagttgggggccgctggtttccagccgtgtgtgca
cacagcaagaaacagggcaagcaagacgcagcggatgcagcccttcgtgtcttgatcggg
gagagcgagaaggcagagcagttgggtttcgcagaggtaaccccagtaaccggggccagt
ctcagaagaactatgctactcctttccaggtccccagatgcacatccaaagacacttcct
ctcactggtagcaccttccacgaccagatagctatgctgagccacagatgcttcaacgct
ctgaccaacagtttccagccctccctgctcggccgcaagatcctggctgctattattatg
aagagagatcctgaggacatgggtgttgttgtcagtttggggactgggaatcgctgtgtg
aaaggggactctctcagcctgaaaggagagactgtcaatgactgccatgctgaaatcatc
tcccggagaggcttcatcaggtttctctacagtgagctgatgaagtacaaccaccacact
gccaagaacagcatattcgagctggccaggggaggagagaagctccagataaaaaagacg
gtttcttttcacctctacatcagcacggcaccatgtggagatggagcccactttgacaaa
tcctgcagtgaccgtgctgtggaaagcacagagtcccgccattaccctgtctttgaaaat
cccaagcaaggcaagcttcgcaccaaggtggagaatggggaaggcacaattcctgtggag
tccagtgacattgtacccacgtgggatggcatccggcttggggaaagactccgtaccatg
tcctgtagtgacaaaatcctacgctggaatgtgctaggcctgcaaggggcgctgttgaca
cacttcctacagcctgtgtacctgaaatctgtgacattaggttaccttttcagccaaggg
catctgacccgtgctatttgctgccgtgtgaccagagatgggaatgcatttgaggatgga
ctacgttatccctttattgtcaaccaccccaaggtcggccgagtcagtgtgtatgattcc
aaaaggcagtccggaaagaccaaagagacaagcgtcaactggtgcttggctgatggctat
gacctggagatcctggatggcaccaggggcaccgtggatggaccagggaaagagttgtcg
cgggtgtctaagaagaatattttccttcagtttaagaagctctgctccttccgagcccgc
agagatttgctgcagctctcctatggggaggccaagaaagctgcccgtgactacgactta
gccaagaactacttcaagaaaagcctgagggacatgggctatgggaattggatcagcaaa
ccccaggaggaaaagaacttttatctctgtccagtgcccaatgactga

DBGET integrated database retrieval system