Salicibibacter kimchii: DT065_11115
Help
Entry
DT065_11115 CDS
T05571
Name
(GenBank) ABC transporter permease
KO
K02034
peptide/nickel transport system permease protein
Organism
rue
Salicibibacter kimchii
Pathway
rue02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
rue00001
]
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
DT065_11115
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rue02000
]
DT065_11115
Transporters [BR:
rue02000
]
ABC transporters, prokaryotic type
Peptide and nickel transporters
Peptides/nickel transporter
DT065_11115
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
OppC_N
Motif
Other DBs
NCBI-ProteinID:
AXF56518
UniProt:
A0A345BZY7
LinkDB
All DBs
Position
2197985..2198911
Genome browser
AA seq
308 aa
AA seq
DB search
MHPNERTQDVKSPPSAPGVEETLSEHQSMLSIIVKKFFQNKLAVIGLIMLLIIISSAVLA
PWLATHDPNAQTLTDRLAPPSADNWLGADHLGRDIFSRILYAGQMSLWVGFAAMVSATTI
GVVIGSIAGYFGGWVDAVLMRIVDIIISFPSIFLLITIISVFRPAPSMLILVFGLLSWTT
TARLVRSEFLSFKNREFVLAARTMGIPTRRIIFGHILPNAIGPVIVAATLAIGMFIIAES
TLSFLGLGISPPTATWGNMLSDSQDLTIFLTAWYYPFFPGLMIFITVLSFNFVGDGLRDA
LDPRVMEK
NT seq
927 nt
NT seq
+upstream
nt +downstream
nt
atgcatccaaacgaaaggacacaagacgtgaaatcgcccccttctgctccgggagtggag
gagacgttaagcgaacaccagtcgatgctcagcattattgttaaaaaattttttcagaac
aagctcgcggtaattgggcttatcatgttgctgatcattattagtagtgcggtgctcgct
ccttggctggcaacgcacgatccgaatgcacagacgctgaccgaccgcctggccccgcca
agtgctgacaactggttgggcgccgatcatttagggcgggatatcttcagccggatttta
tatgccggtcagatgtccctctgggttggctttgccgcgatggttagcgcgacgacaatc
ggtgttgttatcggctcgattgccggttattttggcggttgggttgacgcggtgttgatg
cggatcgttgatattattatatcttttccaagtattttcttgttgatcacgatcatttcc
gtcttccgaccggccccgtccatgctaattctcgttttcggccttttgtcgtggacgacg
acggcacggcttgtaaggagtgaatttctatcttttaaaaatagggaatttgttttggct
gctcgaaccatgggcatcccgacgcgtcggattatttttggacatatcttgccgaatgcc
atcggaccggtgattgttgctgcaacactcgcgattgggatgtttattattgcggaatct
accttgagtttcctcgggctcggcatcagcccgccgacggcaacgtgggggaatatgctc
tcggactcccaggatttaacgatatttttaactgcttggtattatccgtttttcccggga
ttaatgatctttatcactgtccttagctttaacttcgtcggtgatgggttgcgcgatgcg
ttggacccgagggtgatggagaaataa
DBGET
integrated database retrieval system