Sylvia atricapilla (blackcap): 136360871 Help Entry 136360871         CDS       T10263                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism sati  Sylvia atricapilla (blackcap) Pathway sati03050   Proteasome sati04060   Cytokine-cytokine receptor interaction sati04217   Necroptosis sati04350   TGF-beta signaling pathway sati05164   Influenza A sati05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:sati00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     136360871 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     136360871 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136360871 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136360871 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     136360871 (IFNG)    05168 Herpes simplex virus 1 infection     136360871 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:sati03051]     136360871 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sati04052]     136360871 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:sati00536]     136360871 (IFNG) Proteasome [BR:sati03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     136360871 (IFNG) Cytokines and neuropeptides [BR:sati04052]  Cytokines   Interferons    136360871 (IFNG) Glycosaminoglycan binding proteins [BR:sati00536]  Heparan sulfate / Heparin   Cytokines    136360871 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Fib_alpha Lipoprotein_20 ATG14 Sec8_N Csm2_III-A Phage_GP20 ADIP IL31 Talin_middle PP-binding_2 DUF948 Motif Other DBs NCBI-GeneID:  136360871 NCBI-ProteinID:  XP_066174577 LinkDB All DBs Position 5:complement(34225443..34228905) Genome browser AA seq 165 aa AA seqDB search MAFQTYSLFVLSVIMISFGHVENRLNLLQLQNDIDKLKADFNSSHSDVADGGPIFTERLS SWTERNEKRIILSQIISMYLKMLESTDGSKAHVRNIAEELHTLKESLSDGSKKIEDLKDL TKLQMSDLKIQRKAVNELFSVLQKLVDTSSSHKRKRRQFQRLCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggctttccaaacctacagcttgtttgttctgtctgtcatcatgatttcatttggacat gttgaaaatagattgaatcttcttcaacttcaaaatgatatagacaaactgaaagctgat tttaactcaagccattctgatgtagctgatggtggacctatttttacagagaggctgtca agctggacagagagaaatgaaaaaaggatcatcctgagtcagattatttccatgtacttg aaaatgctggaaagtactgacgggtcaaaggctcatgtcaggaacatagctgaggagctc catactctgaaagaaagcctttctgatggctcaaagaagatagaagatctcaaggacctg actaaacttcagatgagtgacttgaaaatccagcgcaaggctgtgaatgagctgttcagc gtcttacaaaaactggtggatacctcaagttctcacaaaagaaaaagaagacagtttcag aggctgtgcaaatgctaa

DBGET integrated database retrieval system