KEGG   Streptomyces bingchenggensis: SBI_09675
Entry
SBI_09675         CDS       T01678                                 
Name
(GenBank) oxidoreductase
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00998  Biosynthesis of various antibiotics
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Module
sbh_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SBI_09675
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     SBI_09675
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase
Other DBs
NCBI-ProteinID: ADI12793
UniProt: D7CBB6
LinkDB
Position
11549840..11550640
AA seq 266 aa
MTGAASGIGLALSARFARAGAGLVMADVEGDALHRRAADLTAQGAQVTAVTADLTDPDAV
ERLADTAFDLLGDIDVVCNNAGVLGPVGQPLWEVPLERMRQVFEVNHWAHVLVARAFVPR
LLERGRPAHLIHTASMSAFVVGAGSAAYAASKHADLAVARSLRADLRGTGVRVSVLCPGR
VDTPMVQGVTAPRGAGGDTSVSAEDVAGLVWEALGSDRFYLFSNSDAPLRLRDQFDDVWR
HVSLPPPSPEEELWPAPKATTATMKR
NT seq 801 nt   +upstreamnt  +downstreamnt
gtgaccggcgcggccagcggcatcggcctcgccctcagcgcccgcttcgcacgggccggc
gccggcctggtcatggcggacgtcgaaggcgacgcactgcaccgccgggccgccgatctc
accgcacagggggctcaggtcaccgcagtgaccgccgacctgaccgacccggacgccgtc
gaacggctcgcggacacggcgttcgacctactcggcgacatcgacgtggtgtgcaacaac
gccggggtcctcggccccgtgggacagcctctgtgggaggtgccgctggagcggatgcgg
caggtcttcgaggtgaaccactgggcgcacgtcctggtggcccgtgccttcgtcccccgg
ctgctggagcgcggccgacccgctcatctgatccacaccgcctcgatgtccgccttcgtc
gtcggcgccggcagcgccgcctacgccgcctccaagcacgccgacctcgcggtcgcccgc
agtctgcgcgccgatctgcggggcaccggggtccgggtgtcggtgctgtgtcccggccgg
gtcgacacccccatggtccaaggcgtgacggccccgcgcggcgcgggcggcgacacctcg
gtgagcgccgaggacgtcgccggactcgtgtgggaggccctcggctccgatcgcttctat
ctcttcagcaactccgacgccccgctgcggctgcgcgatcagttcgacgacgtatggcgt
catgtttcccttccacccccttcccccgaggaggagctgtggcccgcgccgaaagcgacg
accgcgacgatgaaacgctga

DBGET integrated database retrieval system