KEGG   Streptomyces collinus: B446_29675
Entry
B446_29675        CDS       T02787                                 
Name
(GenBank) oxidoreductase
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
sci  Streptomyces collinus
Pathway
sci00998  Biosynthesis of various antibiotics
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    B446_29675
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     B446_29675
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase HerA_C
Other DBs
NCBI-ProteinID: AGS72741
UniProt: S5V4R9
LinkDB
Position
6867431..6868258
AA seq 275 aa
MVTGAASGIGLALTARLARAGVKVLMADIQGDALRHRAGELAARGADVRAETVDLTDADA
VQALAETAYGTFGDIDVVCNNAGVVGPVGMPLWEVPPARMREVFEVNHWAHVHVARAFVP
RLLAGGRPAHLVHTASMSAFAVGSGSAAYAASKHADLAVARSLRADLAGTPVRVSVLCPG
RVDTPLVRGLAAPRDATGDTTVTAGLVAETVWDALGSDRFYLFTNADAATRLRDQFDDVR
RHLTSPVHPTQETLWNASGQTPPTAPRPNPPTSGG
NT seq 828 nt   +upstreamnt  +downstreamnt
gtggtcaccggcgcggcgagcggtatcgggctcgccctcaccgcccgcctcgcccgggcc
ggagtcaaggtgctcatggcggacatccagggcgacgccctgcgccaccgggccggcgaa
ctcgccgcgcgcggcgcggacgtccgcgccgagaccgtggacctcaccgacgcggacgcc
gtgcaggcactggccgagacggcgtacggcaccttcggcgacatcgacgtggtctgcaac
aacgccggtgtcgtcggccccgtcggcatgccgctgtgggaggtgccgccggcgcggatg
cgcgaggtcttcgaggtgaaccactgggcgcacgtccatgtcgcccgcgccttcgtgccg
cggctgctggccggcggccggcccgcccacctcgtgcacaccgcctccatgtcggcgttc
gccgtgggcagcggcagcgccgcctacgccgcctccaagcacgccgacctggcggtcgcc
cgcagcctgcgggccgacctcgccggcacccccgtgcgggtctcggtgctctgcccaggc
cgggtcgacaccccgctggtccgcggcctcgccgccccgcgcgacgcgaccggggacacc
acggtcaccgccggcctggtcgccgagaccgtgtgggacgcgctgggctccgaccgtttc
tacctcttcaccaacgccgacgcggccacccggctgcgcgaccagttcgacgacgtacgg
cgccacctcacctcccctgtccaccccacgcaggagacgctgtggaacgcttccgggcag
acgcccccgacggccccgcgaccgaacccgccgacctcgggagggtga

DBGET integrated database retrieval system