Staphylococcus condimenti: A4G25_03110 Help Entry A4G25_03110       CDS       T04648                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scv  Staphylococcus condimenti Pathway scv01100   Metabolic pathways scv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4G25_03110    00074 Mycolic acid biosynthesis     A4G25_03110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4G25_03110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AMY04972 UniProt:  A0A143P8Z0 LinkDB All DBs Position complement(632365..632598) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINNLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagttaaagatatcatcgttgaccgtttaggtgtagatgctgac aaagtaactgaagacgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattcctgatgaagaagctgaa aaaatcaatacagttggtgacgcagttaatttcatcaacaaccttgaaaaataa

DBGET integrated database retrieval system