KEGG   Streptomyces glaucescens: SGLAU_26370
Entry
SGLAU_26370       CDS       T03327                                 
Symbol
tcmN
Name
(GenBank) Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN
  KO
K15886  multifunctional cyclase / dehydratase / O-methyltransferase [EC:2.3.1.235]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu01056  Biosynthesis of type II polyketide backbone
sgu01057  Biosynthesis of type II polyketide products
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Module
sgu_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
sgu_M00783  Tetracenomycin C/8-demethyltetracenomycin C biosynthesis, tetracenomycin F2 => tetracenomycin C/8-demethyltetracenomycin C
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SGLAU_26370 (tcmN)
   01057 Biosynthesis of type II polyketide products
    SGLAU_26370 (tcmN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sgu01008]
    SGLAU_26370 (tcmN)
Enzymes [BR:sgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     SGLAU_26370 (tcmN)
Polyketide biosynthesis proteins [BR:sgu01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C14 cyclized polyketide type
    Decaketide PKS
     SGLAU_26370 (tcmN)
 Polyketide tailoring proteins
  Methylase
   SGLAU_26370 (tcmN)
SSDB
Motif
Pfam: Methyltransf_2 Polyketide_cyc Polyketide_cyc2 Methyltransf_25 MTS
Other DBs
NCBI-ProteinID: AIS01212
UniProt: A0A089XH06
LinkDB
Position
6014888..6016372
AA seq 494 aa
MAARTDNSIVVNAPFELVWDVTNDIEAWPELFSEYAEAEILRQDGDGFDFRLKTRPDANG
RVWEWVSHRVPDKGSRTVRAHRVETGPFAYMNLHWTYRAVAGGTEMRWVQEFDMKPGAPF
DNAHMTAHLNTTTRANMERIKKIIEDRHREGQRTPASVLPTELHAQQLLLLAASGRLARI
VHVLTELRIADLLADGPRHVAELAKETDTHELSLYRVLRSAASVGVFAEGPVRTFSATPL
SDGLRTGNPDGVLPLVKYNNMELTRRPYDEIMHSVRTGEPAFRRVFGSSFFEHLEANPEA
GEFFERFMAHWSRRLVLDGLADQGMERFSRIADLGGGDGWFLAQILRRHPHATGLLMDLP
RVAASAGPVLEEAKVADRVTVLPGDFFTDPVPTGYDAYLFKGVLHNWSDERAVTVLRRVR
EAIGDDDARLLIFDQVMAPENEWDHAKLLDIDMLVLFGGRERVLAEWRQLLLEADFDIVN
TPSHTWTTLECRPV
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggcagcgcgcacggacaactccatcgtcgtcaacgcgccgttcgagctcgtctgggac
gtcaccaacgacatcgaggcatggccggagctgttctccgagtacgccgaggcggagatc
ctccggcaggacggcgacggcttcgacttccggctcaagacccgccccgacgcgaacgga
agggtctgggagtgggtctcccaccgtgtgcccgacaagggctcccgcacggtccgggcg
caccgcgtcgagaccgggcccttcgcctacatgaacctgcactggacctaccgggccgtg
gccgggggcaccgagatgcggtgggtgcaggagttcgacatgaagcccggggccccgttc
gacaacgcgcacatgaccgctcacctcaacacgacgacacgggcgaacatggagcgcatc
aagaagatcatcgaggacaggcaccgggaaggacagcggaccccggcgtccgtcctgccc
accgaactgcacgcccagcaactgctgttgctggccgcctccgggcgcctggcgcggatc
gtccacgtgctgaccgagctgaggatcgccgatctcctcgccgacggcccccgtcacgtc
gcggaactggccaaggagacggacacccacgagctctccctctaccgcgtcctgcgcagc
gccgcctccgtcggcgtcttcgcggaggggcccgtcaggaccttctccgcgacgcccctg
tcggacggactgcgcaccggcaacccggacggtgtgctgcccctggtgaagtacaacaac
atggagctgaccaggcggccctacgacgagatcatgcacagtgtgcgcaccggcgaaccg
gccttccggcgggtgttcggcagctcgttcttcgagcacctggaggccaacccggaagcc
ggcgagttcttcgagcggttcatggcccactggagccgccggctcgtcctcgacggactc
gccgaccagggcatggagcgcttctcgcgcatcgcggacctcggcggtggcgacggctgg
ttcctcgcccagatcctccggcgccacccgcacgccacgggcctgctcatggacctcccg
cgggtggccgcgtcggccggccccgtcctggaggaggccaaagtcgccgaccgggtcacc
gtgctgcccggcgacttcttcacggaccccgtccccaccggctacgacgcctacctcttc
aagggcgtgctgcacaactggtccgacgagcgggccgtgaccgtgctgcgccgggtccgg
gaggccatcggcgacgacgacgcacgcctgctgatcttcgaccaggtcatggcccccgag
aacgagtgggaccacgccaagctgctggacatcgacatgctggtgctcttcggaggccgc
gaacgggtgctggccgagtggcggcagctgctgctcgaggcggacttcgacatcgtcaac
acgccctcccacacctggaccacgctggagtgccgccccgtctag

DBGET integrated database retrieval system