Sturnira hondurensis: 118993073 Help Entry 118993073         CDS       T07222                                  Symbol CASP3 Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism shon  Sturnira hondurensis Pathway shon01524   Platinum drug resistance shon04010   MAPK signaling pathway shon04115   p53 signaling pathway shon04148   Efferocytosis shon04210   Apoptosis shon04215   Apoptosis - multiple species shon04623   Cytosolic DNA-sensing pathway shon04650   Natural killer cell mediated cytotoxicity shon04657   IL-17 signaling pathway shon04668   TNF signaling pathway shon04726   Serotonergic synapse shon04932   Non-alcoholic fatty liver disease shon04933   AGE-RAGE signaling pathway in diabetic complications shon04936   Alcoholic liver disease shon05010   Alzheimer disease shon05012   Parkinson disease shon05014   Amyotrophic lateral sclerosis shon05016   Huntington disease shon05020   Prion disease shon05022   Pathways of neurodegeneration - multiple diseases shon05132   Salmonella infection shon05133   Pertussis shon05134   Legionellosis shon05145   Toxoplasmosis shon05146   Amoebiasis shon05152   Tuberculosis shon05160   Hepatitis C shon05161   Hepatitis B shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05165   Human papillomavirus infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05203   Viral carcinogenesis shon05205   Proteoglycans in cancer shon05206   MicroRNAs in cancer shon05210   Colorectal cancer shon05222   Small cell lung cancer shon05416   Viral myocarditis shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118993073 (CASP3)    04668 TNF signaling pathway     118993073 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     118993073 (CASP3)   09143 Cell growth and death    04210 Apoptosis     118993073 (CASP3)    04215 Apoptosis - multiple species     118993073 (CASP3)    04115 p53 signaling pathway     118993073 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     118993073 (CASP3)    04650 Natural killer cell mediated cytotoxicity     118993073 (CASP3)    04657 IL-17 signaling pathway     118993073 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     118993073 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118993073 (CASP3)    05206 MicroRNAs in cancer     118993073 (CASP3)    05205 Proteoglycans in cancer     118993073 (CASP3)    05203 Viral carcinogenesis     118993073 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     118993073 (CASP3)    05222 Small cell lung cancer     118993073 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118993073 (CASP3)    05161 Hepatitis B     118993073 (CASP3)    05160 Hepatitis C     118993073 (CASP3)    05164 Influenza A     118993073 (CASP3)    05162 Measles     118993073 (CASP3)    05168 Herpes simplex virus 1 infection     118993073 (CASP3)    05163 Human cytomegalovirus infection     118993073 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     118993073 (CASP3)    05169 Epstein-Barr virus infection     118993073 (CASP3)    05165 Human papillomavirus infection     118993073 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     118993073 (CASP3)    05133 Pertussis     118993073 (CASP3)    05134 Legionellosis     118993073 (CASP3)    05152 Tuberculosis     118993073 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     118993073 (CASP3)    05145 Toxoplasmosis     118993073 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     118993073 (CASP3)    05012 Parkinson disease     118993073 (CASP3)    05014 Amyotrophic lateral sclerosis     118993073 (CASP3)    05016 Huntington disease     118993073 (CASP3)    05020 Prion disease     118993073 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     118993073 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118993073 (CASP3)    05416 Viral myocarditis     118993073 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118993073 (CASP3)    04932 Non-alcoholic fatty liver disease     118993073 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     118993073 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     118993073 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:shon01002]     118993073 (CASP3) Enzymes [BR:shon01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      118993073 (CASP3) Peptidases and inhibitors [BR:shon01002]  Cysteine peptidases   Family C14: caspase family    118993073 (CASP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  118993073 NCBI-ProteinID:  XP_036911052 LinkDB All DBs Position Unknown AA seq 277 aa AA seqDB search MENTENSVDSKSIKNSETRLIHGSKSVDSGIPLDCSYKMDYPEMGVCLIINNKNFHKNTG MTCRSGTDVDAANLRETFMNLKYEVRNKNDLTCEEMVELMRSVSEEDHGKRSSFVCVLLS HGEEGVIFGTNGAVELRDLTRFFRGDCCRSLTGKPKLFIVQACRGTELDCGIETDSGVDD DVTCQKIPVEADFLYAYSTAPGYYSWRNAKDGSWFIQALCAMLKQYADKLELMHILTRVN RKVAIEFESFSFDPNFHAKKQIPCIVSMLTRELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagaacacggaaaactcagtggattcaaaatccattaaaaactcagaaacgaggctc atacatggcagtaaatcagtggactctgggatacccttggactgtagttacaaaatggac taccccgaaatgggcgtctgcttaataatcaataataaaaactttcataaaaatactgga atgacatgtcggtctggcacagatgtagacgcagcaaacctcagggagacgttcatgaac ttgaaatacgaagtcaggaacaaaaacgatcttacatgcgaagaaatggtggaattgatg cgcagcgtttctgaagaagaccatggcaagaggagcagtttcgtctgcgtgcttctgagc cacggggaggaaggcgtcatttttggaacaaacggagccgttgagctgcgagacttaacg cgtttcttccgcggggattgctgcaggagtctgaccggaaagcccaagcttttcattgtt caggcctgccgaggcacagagctggactgcggcatcgagaccgacagcggcgttgacgat gacgtgacgtgtcagaaaattcccgtggaggcagacttcctgtatgcgtattctacagcg cctggttactattcctggagaaatgccaaggacgggtcctggttcatccaggcactctgt gctatgctgaaacagtacgcggacaagctggagctcatgcacattctgactcgggttaac cggaaggtagcgatagaatttgagtccttttccttcgaccctaactttcatgcaaagaaa cagattccatgcattgtttctatgctcacaagagagctgtatttttatcactaa

DBGET integrated database retrieval system