Scomber japonicus (chub mackerel): 128361867 Help Entry 128361867         CDS       T09718                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo03030   DNA replication sjo03410   Base excision repair sjo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sjo00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     128361867 (pole4)    03410 Base excision repair     128361867 (pole4)    03420 Nucleotide excision repair     128361867 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sjo03032]     128361867 (pole4)    03400 DNA repair and recombination proteins [BR:sjo03400]     128361867 (pole4) Enzymes [BR:sjo01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      128361867 (pole4) DNA replication proteins [BR:sjo03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     128361867 (pole4) DNA repair and recombination proteins [BR:sjo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       128361867 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  128361867 NCBI-ProteinID:  XP_053178415 LinkDB All DBs Position 7:complement(15747320..15749672) Genome browser AA seq 131 aa AA seqDB search MAATVATPITPVEHDPDRCGSEEESRGAEAEEESSRQQTGPAAAATHSRLSKLPLARIKA LMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLDTA NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcagcgacagtggcaacacctatcaccccagtggagcacgaccccgaccgatgtggg agcgaggaggagagtcgcggggccgaggcagaggaggagagcagtcgccagcagacgggc ccagccgcggctgcgacccacagccggctgtccaaactcccgctggcccgcattaaggct ttgatgaagaccgacccagatgtgtctctcgccagccaggagtcagtgttcatcatcgct aaagccacggagttgtttgttgagatgattgccaaagatgccctggtgtacgcccagcaa gggaagagaaaaacgttgcaaaggaaagatttggacaatgcaatcgaggccatagatgag tttgcattccttgaaggcacattagacactgcttga

DBGET integrated database retrieval system