KEGG   Streptomyces leeuwenhoekii: sle_13200
Entry
sle_13200         CDS       T04414                                 
Symbol
sle_13200
Name
(GenBank) Probable oxidoreductase ephD
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00998  Biosynthesis of various antibiotics
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
Module
sle_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    sle_13200 (sle_13200)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     sle_13200 (sle_13200)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase Methyltransf_25 3HCDH_N GDP_Man_Dehyd Ldh_1_N
Other DBs
NCBI-ProteinID: CQR60782
UniProt: A0A0F7VTB8
LinkDB
Position
chromosome:complement(1638966..1639766)
AA seq 266 aa
MVTGAASGIGLALSARFARAGARVVMADVADDALHRRAAELTAQDAQVTAVTADLTDPDA
VEQLADTAFGLLGDVDVVCNNAGVLGPVGQPLWEVPLERMRQVFEVNHWAHVLVARAFVP
RLLERGRPAHLIHTASMSAFVVGAGSAAYAASKHADLAVARSLRADLRGTGIRVSVLCPG
RVDTPMVQGLTAPRGAGGDTSVSAEDVAGLVWEALGTDRFYLFSNADAPQRLRDQFDDVW
RDISLPPPSPEEEPWPAPKATTAMKP
NT seq 801 nt   +upstreamnt  +downstreamnt
gtggtgaccggcgcggccagcggcatcggcctcgccctcagcgcccgcttcgcacgggcc
ggtgcccgcgtggtcatggcggacgtcgcagacgacgccctgcaccgccgggccgccgaa
ctcaccgcacaggacgcccaggtcaccgcggtgaccgccgacctgaccgacccggacgcc
gtcgaacagctcgcggacacggcgttcggcctgctcggcgacgtcgacgtggtgtgcaac
aacgccggggtcctcggccccgtgggacagcccctgtgggaggtgccgctggaacggatg
cggcaggtcttcgaggtgaaccactgggcgcacgtcctggtggcccgcgccttcgtcccc
cggctgctggagcgcggccggcccgcccacctgatccacaccgcctcgatgtccgccttc
gtcgtcggcgccggcagcgccgcctacgccgcctccaaacacgccgacctcgcggtcgcc
cgcagtctgcgcgccgatctgcggggcaccggcatccgggtgtcggtgctgtgtcccggc
cgggtcgacaccccgatggtccagggtctgacggccccgcgcggcgcgggcggcgacacc
tcggtgagcgccgaggacgtcgccgggctcgtgtgggaggccctcggcaccgaccgcttc
tacctcttcagcaacgccgacgccccgcagcggctgcgcgaccagttcgacgacgtatgg
cgtgatatttcccttccgcccccttcccccgaggaggagccgtggcccgcgccgaaagcg
acgaccgcgatgaaaccctga

DBGET integrated database retrieval system