KEGG   Streptomyces avermitilis: SAVERM_2993
Entry
SAVERM_2993       CDS       T00126                                 
Symbol
ptlF
Name
(GenBank) 1-deoxy-11beta-hydroxypentalenic acid dehydrogenase
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
sma  Streptomyces avermitilis
Pathway
sma00998  Biosynthesis of various antibiotics
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SAVERM_2993 (ptlF)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     SAVERM_2993 (ptlF)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Methyltransf_25 AIRS_C GDP_Man_Dehyd Ldh_1_N
Other DBs
NCBI-ProteinID: BAC70704
NITE: SAV2993
UniProt: Q82IY9
LinkDB
Position
3749307..3750119
AA seq 270 aa
MHLQPSTAVVTGAASGIGFALSARLAQAGARVVMTDIAGDGLAGAVEELAAHGADVTAVV
ADLTDPAAVQELADTAFGRLGDIDVVCNNAGVVGPVGMPLWSVPLDEMHAVFDVNYWAHV
HVARAFVPRLLDSGRPSHLVQTASMSAFVVGAGTASYAASKHADLAAARSLRADLDGTPV
RVSVLCPGRVDTPMTRGLVAPRNATGNTTISADEAADAVWNALGSDRFYIFTNADAQTRL
GDQFNDVWRHLAREKYWTESSSPSVNSSRP
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcaccttcaaccgagtacggccgtcgtgaccggcgcggcgagtggcatcggtttcgcg
ctcagcgcccgactggcacaagcgggcgccagggtcgtgatgacggacatcgcgggtgac
ggcctggccggggccgtcgaggagctggccgcgcacggcgcggacgtcaccgccgtggtc
gccgacctcaccgacccggccgcggttcaggagctggccgacacggccttcgggcggctc
ggcgacatcgacgtggtctgcaacaacgcaggcgtcgtcggaccggtcggaatgccgctg
tggagcgttcccctggacgagatgcacgctgtcttcgacgtcaactactgggcgcacgtc
catgtcgcgcgggccttcgtgccgcgcctcctcgacagcgggcgcccctcgcacctcgtg
cagaccgcctcgatgtccgcgttcgtcgtcggcgcgggtaccgcgtcgtacgccgcgtcc
aagcatgcggacctggccgcggcccgaagccttcgggcggacctcgacggcactcccgtg
cgggtctcggttctctgcccggggcgggtcgacacaccgatgacccggggtcttgtcgct
ccccggaacgcgaccgggaacacgacgatcagcgcggacgaagcggccgacgcggtgtgg
aacgcgctgggctcggaccgcttctacatattcaccaacgccgatgcccaaaccaggctc
ggcgatcaattcaacgacgtatggcgccatctggcacgggaaaagtactggaccgaatcc
tcttcaccgagcgttaacagttctcgcccatga

DBGET integrated database retrieval system