KEGG   Trichosporon asahii var. asahii: A1Q1_03733
Entry
A1Q1_03733        CDS       T06566                                 
Name
(RefSeq) cytochrome P450nor
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
tasa  Trichosporon asahii var. asahii
Pathway
tasa00910  Nitrogen metabolism
tasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tasa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    A1Q1_03733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tasa00199]
    A1Q1_03733
Enzymes [BR:tasa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     A1Q1_03733
Cytochrome P450 [BR:tasa00199]
 Cytochrome P450, fungi type
  CYP55 family
   A1Q1_03733
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 25987246
NCBI-ProteinID: XP_014178958
UniProt: J5QIE0
LinkDB
Position
Unknown
AA seq 397 aa
MAFSPKFPFNRASGMEPPAEFATLRATNPVSQVQLYDGSLAWLVTKYEDVIKVATDERLS
KVRTRPGFPELSAGGKAAAQAQPTFVDMDAPDHMRQRGLVESFFTPEYVESLKPYIQRVI
DETLDKMAAKDKPVDFVSEFALIVPSYVIYTILGVPFKDLEFLTHQNAIRTNGSSTAREA
SAAAAGLIDYLGKLVDARMKEPKDDLVSTLCKAVEAGKLDRTSAVQVAFLLLVAGNATMV
NMIALGVATLAKYPSQLELLKADPSLAANMVQELCRYHTASAMALKRVALEDVVIGGKTI
KAGEGIIASNYSGNRDADAFPDPDTFDIRRKFDKDPLAFGWGPHRCIAEHLAKAELTAVF
ETLYKRLPNLKPAVPIEDIEYSPLDKDVGIVSLPVTW
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggccttttcgcccaagttccccttcaaccgcgctagcggcatggaaccgcccgccgag
tttgctaccctccgcgcgaccaaccccgtctcgcaggtgcagctttacgacggctccctc
gcctggctcgtcaccaaatacgaggatgtgatcaaggttgcgaccgacgagcgcctgtcc
aaagtccgcactcgtcccggtttccccgagctgagcgccggcggcaaggctgccgcgcag
gctcagcccacgtttgtcgacatggacgcgcccgatcacatgaggcagcgtggcctcgtc
gaatccttcttcacccccgagtacgtcgagtcgctcaagccctacatccagcgcgtcatt
gacgagacgctcgacaagatggcggccaaggacaaacccgttgacttcgtgtccgagttt
gcactcatcgtgccctcctacgtcatctacacaatcctgggcgtgccgttcaaggacctc
gagttcctcactcatcagaatgccattcgcacgaacggctcgtcaaccgcccgagaggcg
agtgctgccgccgctggcctcatcgactacctcggcaagctcgtcgatgcccgcatgaag
gagcccaaggacgaccttgtcagcaccctttgcaaggccgttgaagccggtaagctcgac
cgcacgagcgccgtgcaggtcgcattcctccttctcgttgccggcaatgcgaccatggtc
aacatgattgcgctcggtgttgcgacgctggccaagtacccctcccagctcgagctgctc
aaggcagatccctcgctggccgccaacatggtgcaggagctctgccgctaccacaccgca
agcgccatggccctgaagcgtgttgcgcttgaggacgtggtcattggtggtaagacgatc
aaggccggcgagggcatcatcgcgagcaactacagcggaaaccgcgacgcggacgcgttc
ccggaccccgacactttcgacattcgccgcaagtttgacaaggaccctcttgcgtttggg
tgggggccccaccgctgcattgcggagcacctcgctaaggctgagctcaccgctgtgttt
gagacgctgtataagcgtcttccaaacctcaagccggccgtgcccatcgaggatatcgag
tacagtcccctcgacaaggatgtcggtatcgtctcgctccccgtcacgtggtag

DBGET integrated database retrieval system