KEGG   Trichechus manatus latirostris (Florida manatee): 101348075
Entry
101348075         CDS       T05135                                 
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00250  Alanine, aspartate and glutamate metabolism
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101348075
Enzymes [BR:tmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     101348075
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     101348075
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 101348075
NCBI-ProteinID: XP_004371932
UniProt: A0A2Y9DCB3
LinkDB
Position
Unknown
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTLPDVVLVRVSTPSVQSDSEITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHDDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMALLPGLSSPREKKEPDGCASAQGVPESVYTINNGSTSSESEPELGEIQD
PSASTMGAPSPMLPEPSYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacagaccgccggatccgcgaggactacccgcaagtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggtggccacctcggtctgcagttgaatcag
aaggcactcaccactctcccagatgtggtgcttgtgcgggtgtccacaccctctgtgcaa
tcagatagtgaaatcactgtcttgcgacacctggagaagttgggctgccgcttagtcaac
cgcccacagagcattttaaactgcatcaacaaattctggacattccaagagctggctggg
catggggtccccatgccagacacattctcctatggtgggcatgacgacttttcaaaaatg
attgatgaagccgagcccctgggctacccggtggtggtgaagagcacacggggacaccga
ggaaaagctgtttttcttgcaagagataagcatcacctttcagacatctgccatttgatc
cgccatgatgtgccctacctgttccagaagtatgtgaaagaatcacatggaaaagatatc
cgggtggtggtcgtagggggccaagtgataggctctatgcttcgctgctccacagacgga
cggatgcaaagcaactgctctctcggtggtgtgggtgtcatgtgcccgctgacggaacaa
ggcaagcagttggctattcaagtgtccaatatcctaggcatggacttctgtggtattgat
ctcctcatcatggatgatggctcctttgtggtgtgtgaagcaaacgccaacgttggtttc
ctagcattcgaccaggcttgcaacttagatgtgggtgggatcattgcagactacaccatg
tccttgctgccaaacaggcagactgggaagatggctctcctcccaggactgtctagtccc
agggagaagaaggagccagatggctgtgcttcagctcagggagttccagagagcgtctac
accatcaacaacgggtctacctctagtgagagtgagcctgaactgggagagatccaagat
ccctcagcaagcacaatgggggctccatcccccatgctgcccgaacccagctacaacatt
aacaacaggattgcttccgaattaaaacttaagtga

DBGET integrated database retrieval system