Talpa occidentalis (Iberian mole): 119257947 Help Entry 119257947         CDS       T07495                                  Symbol CASP3 Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01524   Platinum drug resistance tod04010   MAPK signaling pathway tod04115   p53 signaling pathway tod04148   Efferocytosis tod04210   Apoptosis tod04215   Apoptosis - multiple species tod04623   Cytosolic DNA-sensing pathway tod04650   Natural killer cell mediated cytotoxicity tod04657   IL-17 signaling pathway tod04668   TNF signaling pathway tod04726   Serotonergic synapse tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod04936   Alcoholic liver disease tod05010   Alzheimer disease tod05012   Parkinson disease tod05014   Amyotrophic lateral sclerosis tod05016   Huntington disease tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05133   Pertussis tod05134   Legionellosis tod05145   Toxoplasmosis tod05146   Amoebiasis tod05152   Tuberculosis tod05160   Hepatitis C tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05165   Human papillomavirus infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05200   Pathways in cancer tod05203   Viral carcinogenesis tod05205   Proteoglycans in cancer tod05206   MicroRNAs in cancer tod05210   Colorectal cancer tod05222   Small cell lung cancer tod05416   Viral myocarditis tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119257947 (CASP3)    04668 TNF signaling pathway     119257947 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     119257947 (CASP3)   09143 Cell growth and death    04210 Apoptosis     119257947 (CASP3)    04215 Apoptosis - multiple species     119257947 (CASP3)    04115 p53 signaling pathway     119257947 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     119257947 (CASP3)    04650 Natural killer cell mediated cytotoxicity     119257947 (CASP3)    04657 IL-17 signaling pathway     119257947 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     119257947 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119257947 (CASP3)    05206 MicroRNAs in cancer     119257947 (CASP3)    05205 Proteoglycans in cancer     119257947 (CASP3)    05203 Viral carcinogenesis     119257947 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     119257947 (CASP3)    05222 Small cell lung cancer     119257947 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119257947 (CASP3)    05161 Hepatitis B     119257947 (CASP3)    05160 Hepatitis C     119257947 (CASP3)    05164 Influenza A     119257947 (CASP3)    05162 Measles     119257947 (CASP3)    05168 Herpes simplex virus 1 infection     119257947 (CASP3)    05163 Human cytomegalovirus infection     119257947 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     119257947 (CASP3)    05169 Epstein-Barr virus infection     119257947 (CASP3)    05165 Human papillomavirus infection     119257947 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     119257947 (CASP3)    05133 Pertussis     119257947 (CASP3)    05134 Legionellosis     119257947 (CASP3)    05152 Tuberculosis     119257947 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     119257947 (CASP3)    05145 Toxoplasmosis     119257947 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     119257947 (CASP3)    05012 Parkinson disease     119257947 (CASP3)    05014 Amyotrophic lateral sclerosis     119257947 (CASP3)    05016 Huntington disease     119257947 (CASP3)    05020 Prion disease     119257947 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     119257947 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119257947 (CASP3)    05416 Viral myocarditis     119257947 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     119257947 (CASP3)    04932 Non-alcoholic fatty liver disease     119257947 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     119257947 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     119257947 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:tod01002]     119257947 (CASP3) Enzymes [BR:tod01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      119257947 (CASP3) Peptidases and inhibitors [BR:tod01002]  Cysteine peptidases   Family C14: caspase family    119257947 (CASP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  119257947 NCBI-ProteinID:  XP_037382298 LinkDB All DBs Position Unknown AA seq 277 aa AA seqDB search MEYSENSVDSKSIKNSEMKIFHGSKSMDSGISLDNSYKMDYPEMGLCVIINNKNFLGSTG MACRSGTDEDAAKLRETFLNLKYEVQNKNDLTCKEIKELMYDVSKEDHSKRSSFVCVLLS HGDEGIIYGTDGPIDLKILTGYFKGENCRSLTGKPKLFIIQACRGTDLDSGIETDSGTDD DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLELMHILTRVN QKVAREYESFSLNSTFHAKKQIPCIVSMLTKELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagtactctgaaaactcagtggattcaaaatccattaaaaattcagaaatgaagatc ttccatggaagcaaatcaatggactctgggatatccttggacaatagttacaaaatggat tatcctgaaatgggtttatgtgtaataattaataataagaactttcttgggagtactgga atggcatgtcggtctggtacagatgaagatgcagcaaagctcagggaaacattcctgaac ttgaaatatgaagtccagaataaaaatgatcttacatgtaaagaaattaaagaattgatg tacgatgtttctaaagaagatcacagcaagaggagcagttttgtttgtgtgcttctgagc catggtgacgaaggaataatctatggaacagatggccctattgacctgaaaatactgaca ggttatttcaaaggggaaaactgtagaagtctaaccggaaaacccaagcttttcattatt caggcttgccgaggtacagatctggactctggtattgagactgacagtggtactgatgat gacatggcatgtcacaaaataccagttgaagcagacttcttgtatgcatactctacagcg cctggttactactcctggcgaaattcaaaggatgggtcctggttcatccagtcactttgt gcaatgctgaaactgtacgctcacaaacttgaactcatgcacattcttactcgggttaac caaaaggtagcgagagaatatgagtccttttccttgaactccacttttcatgcaaagaag cagattccatgtattgtgtccatgctcacaaaagaactgtatttttatcattaa

DBGET integrated database retrieval system