KEGG   Thermofilum pendens: Tpen_1605
Entry
Tpen_1605         CDS       T00446                                 

Name
(GenBank) Pyridoxal-5'-phosphate-dependent enzyme, beta subunit
  KO
K10150  cysteine synthase / O-phosphoserine sulfhydrylase / cystathionine beta-synthase [EC:2.5.1.47 2.5.1.65 4.2.1.22]
Organism
tpe  Thermofilum pendens
Pathway
tpe00260  Glycine, serine and threonine metabolism
tpe00270  Cysteine and methionine metabolism
tpe00920  Sulfur metabolism
tpe01100  Metabolic pathways
tpe01110  Biosynthesis of secondary metabolites
tpe01120  Microbial metabolism in diverse environments
tpe01230  Biosynthesis of amino acids
Module
tpe_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:tpe00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tpen_1605
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpen_1605
   00270 Cysteine and methionine metabolism
    Tpen_1605
Enzymes [BR:tpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Tpen_1605
    2.5.1.65  O-phosphoserine sulfhydrylase
     Tpen_1605
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     Tpen_1605
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: ABL79000
UniProt: A1S0M0
LinkDB
Position
1552983..1554131
AA seq 382 aa
MDARFRGDEHLRRVLEVASRILREGRVKCLSGRPEDALVEEALAMLGCRVPRCGEAPAEC
SLEELGFYEDVSPSTLRVFNSTEELLYKNWPTPLVRLNSLGDGKVRAWAKLEFFNPFSMS
VKDRIGWYMVKKLLEKHPGASLALYEATSTNTGMALAAMGAIKGFRVKLFLPETIQKASD
TLLSVMGAEVRRVPKSLTVEFIDDVEHLAKEEGGVHLNQFENDANFGVHLRYTAKELDLQ
VRSAKLNLRGIVGGLGTSGHLSALSLYFKSRYSDVKIYGVQPAPGTVIPGIRRVETGMKW
VHYVSVDKVVDVTPEEAVAHAVKVARREGILVGLSSGAVTAAFEALYSGGELPEGDYVLV
YPDHGFKYVEQFSKYLPIIHQR
NT seq 1149 nt   +upstreamnt  +downstreamnt
gtggacgcgcgtttccgcggagacgagcacttgaggagagtgctcgaagtagcttcgagg
attcttagggagggccgcgttaagtgcttgtccgggaggcccgaggacgccctagtggag
gaggccctcgctatgctcgggtgcagggttccgcggtgcggagaggcgcccgcggagtgt
agcctggaggagctcggcttctacgaagacgtgtcgccgtccacccttagggttttcaac
agcaccgaggagctcctctacaagaactggcccacgcccctcgtgaggctcaactctctg
ggcgacgggaaggtgcgcgcctgggctaagctcgagttcttcaacccgttcagcatgagc
gttaaggacaggattggctggtacatggtgaagaagctcctcgaaaagcatcccggcgcg
agcctcgcgctctacgaggcgacgagcacgaacacggggatggcgctcgctgcgatgggc
gcaattaaagggttcagggtgaagctcttcctcccggagactatccaaaaggcttccgac
actctgctgtcagtcatgggggcagaagtgcgcagagtgccgaaaagcctcacagtcgag
tttatagacgacgtggagcacctagcgaaagaggagggcggggtacacctaaaccagttc
gaaaacgacgcgaacttcggggtacacctgaggtacacggccaaggagctagacctccag
gttagaagcgcaaagctaaatctgcgcggcatcgtaggggggctggggacctccgggcac
ctctcagcgctctcgctgtactttaagagcaggtacagcgacgtgaagatatacggcgtt
caacccgcccccggcaccgtgatccccgggatcaggagggtggagacgggtatgaagtgg
gttcactacgtatccgtggacaaggtggtcgacgtaaccccggaggaggcggtcgcccac
gccgtgaaggtggcgaggagggaggggatactggtggggctcagtagcggagcggtaacg
gcggcgttcgaggctctctacagcggcggcgagctacccgagggcgactacgtactcgta
taccccgaccacggcttcaagtacgtagagcagttctccaagtaccttccaataatccac
cagcgctga

DBGET integrated database retrieval system