Tsukamurella sp. PLM1: MTP03_37800 Help Entry MTP03_37800       CDS       T09545                                  Name (GenBank) hypothetical protein   KO K01659   2-methylcitrate synthase [EC:2.3.3.5] Organism tsd  Tsukamurella sp. PLM1 Pathway tsd00020   Citrate cycle (TCA cycle) tsd00630   Glyoxylate and dicarboxylate metabolism tsd00640   Propanoate metabolism tsd01100   Metabolic pathways tsd01110   Biosynthesis of secondary metabolites tsd01120   Microbial metabolism in diverse environments tsd01200   Carbon metabolism tsd01210   2-Oxocarboxylic acid metabolism tsd01230   Biosynthesis of amino acids Module tsd_M00009   Citrate cycle (TCA cycle, Krebs cycle) tsd_M00010   Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate tsd_M00982   Methylcitrate cycle Brite KEGG Orthology (KO) [BR:tsd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MTP03_37800    00630 Glyoxylate and dicarboxylate metabolism     MTP03_37800    00640 Propanoate metabolism     MTP03_37800 Enzymes [BR:tsd01000]  2. Transferases   2.3  Acyltransferases    2.3.3  Acyl groups converted into alkyl groups on transfer     2.3.3.5  2-methylcitrate synthase      MTP03_37800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Citrate_synt Motif Other DBs NCBI-ProteinID:  BDH58841 LinkDB All DBs Position 3437211..3437594 Genome browser AA seq 127 aa AA seqDB search MTSPTIYKGLAGVVVDTTAVSKVVPETNSLTYRGYAVQDLAARCSFEQVAYLLWNGELPT DAQLQQFTQRERAARRADRSLLGLIARLPESCHPMDVVRTAVSVLGAEDADEWNTGPKAL QDKGYGC NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgaccagtccgaccatctacaagggcctcgccggcgtcgtcgtcgacacgaccgcggtg tcgaaggtcgtgcccgagacgaactccctcacgtatcgcgggtacgccgttcaggacctg gccgcacgctgcagcttcgagcaggtcgcgtacctcctgtggaacggcgagctgccgacg gacgcgcaactgcagcagttcacgcagagggaacgcgccgcccgccgcgccgaccgctca ctgctcggcctgatcgcgcgcctccccgaatcctgccatcccatggacgtcgtgcggacc gccgtcagcgtcctcggcgccgaggacgcggacgagtggaacaccggccccaaggcgttg caggacaagggctacggctgctag

DBGET integrated database retrieval system