KEGG   Vpept: 951475-6
Entry
951475-6          CDS       T49000                                 
Symbol
NS3
Name
(KEGG) Hepatitis C virus protease/helicase protein NS3
  KO
K22273  HCV serine protease / helicase NS3 [EC:3.4.21.98 3.6.1.15 3.6.4.13]
Virus
41856  Hepatitis C virus genotype 1
SSDB
Motif
Pfam: Peptidase_S29 Flavi_DEAD Helicase_C AAA_30 ResIII
Other DBs
NCBI-ProteinID: NP_671491
GB: NC_004102
LinkDB
AA seq 631 aa
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAG
TRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
SPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGA
YMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSI
LGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIK
GGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTG
DFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGE
RPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLT
HIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLY
RLGAVQNEVTLTHPITKYIMTCMSADLEVVT
Comment
vg:951475 1027..1657

DBGET integrated database retrieval system