KEGG   Camelus ferus (Wild Bactrian camel): 102506382
Entry
102506382         CDS       T02979                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2 isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04370  VEGF signaling pathway
cfr04510  Focal adhesion
cfr04650  Natural killer cell mediated cytotoxicity
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04935  Growth hormone synthesis, secretion and action
cfr05034  Alcoholism
cfr05100  Bacterial invasion of epithelial cells
cfr05214  Glioma
cfr05220  Chronic myeloid leukemia
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102506382 (SHC2)
   04014 Ras signaling pathway
    102506382 (SHC2)
   04370 VEGF signaling pathway
    102506382 (SHC2)
   04072 Phospholipase D signaling pathway
    102506382 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102506382 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102506382 (SHC2)
   04062 Chemokine signaling pathway
    102506382 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102506382 (SHC2)
   04915 Estrogen signaling pathway
    102506382 (SHC2)
   04917 Prolactin signaling pathway
    102506382 (SHC2)
   04926 Relaxin signaling pathway
    102506382 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    102506382 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102506382 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102506382 (SHC2)
   05226 Gastric cancer
    102506382 (SHC2)
   05214 Glioma
    102506382 (SHC2)
   05220 Chronic myeloid leukemia
    102506382 (SHC2)
   05224 Breast cancer
    102506382 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    102506382 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102506382 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102506382 (SHC2)
   01522 Endocrine resistance
    102506382 (SHC2)
SSDB
Motif
Pfam: PID SH2 Trypan_PARP Adeno_E1A
Other DBs
NCBI-GeneID: 102506382
NCBI-ProteinID: XP_032322107
LinkDB
Position
22
AA seq 669 aa
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPSGFLGRGPAAARAAGGAGAT
DLEPEPEPEPEPEPEPEPAGPAGVPALAAAVLGACEPRCMAPCPLPALSRCRAAGARGAR
GPRGARGSAGPPDAAADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRS
MRSLDFSTRTQVTREAITRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSIAVSI
SIDGLNLSVPATRQIIANHHMQSISFASGGDTDMADYVAYVAKDPINQRACHILECCEGL
AQSVISTVGQAFELRFKQYLHSPPKVVLPLERLTGLEDSAWGDEEELEHNYYNSIPGKEP
PLGGLVDSRLALTQPCPLGTPGALGQAASPARRDTRGLQWDMGPSAPASPGDGYVQADAR
GPRDYEDHLYVNTQGLDGPEPLQPEDSPQRDLFDMRARSVLPSSEGPFEDALRLHECSVA
AGTAAAPLPVEDQWPSPPTRRAPIAPTEEQLRQEPWYHGQMSRRAAEKLLRADGDFLVRD
SVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRCGPRMHCSKASATWSTTTCSTGSPSWPRG
ASCTCAARSSGSPEPGGDSQPAGPGPAPRCPCRGLRGSSAFVWTLVGPEPPLSLLPLRGS
LESSFSRWP
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcgccccccgcgccccccgcacccccggagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgcggccccc
tccggcttcctgggccgcggcccagcggcggcgcgggcagccgggggcgccggggccacc
gacctcgagcccgagcccgagcccgagcccgagcccgagcccgagcccgagccggctggt
ccggccggcgtccctgcgctggcggccgcggtcctgggcgcctgcgagccgcgctgcatg
gcgccctgtcccctgcctgctctcagccgctgccgggccgctggggcgcggggggcgcgg
gggccgcggggcgcgcgggggtcggccgggcccccggacgccgccgccgacgagtggatc
cgcaaaggcagcttcatccacaagccggcgcacggctggctacacccagacgccagggtc
ctgggtcctggggtctcctacatcgtgcggtacatgggctgcatcgaagtcctccgctcc
atgcgctccctggacttcagcactcgcacccaggtcaccagggaagccatcacccgactc
catgaggctgtgcctggcgtcaggggttcctggaagaagaaggcccccaacaaggcgctg
gcctccatcctgggtaagagcaacctgcgcttcgcaggaatgagcattgcagtcagcatc
tccatcgatggcctcaacctctcggtgccggccacgcgccagatcatcgccaaccaccac
atgcagtccatctccttcgcatcgggtggcgacacggacatggcggattacgtggcctat
gtggccaaggaccccatcaaccagagagcctgccacatcctggagtgctgcgagggcctg
gcccagagtgtcatcagcaccgtggggcaagccttcgagctacgcttcaaacagtacctg
cacagcccccccaaggtggttttgcccctggaaaggctgaccgggctggaggattcggcc
tggggggatgaggaggagctggaacacaactactacaacagcatcccggggaaggagccg
cccctgggcggtctggtggactccaggctcgccctcacacagccctgcccgctcgggacc
cctggagccctcggccaggcagcatctcctgctcgaagagacacccgcggcctgcagtgg
gacatgggcccctcagcgccagcctcgcctggggacggctacgtgcaggcggacgcccgg
ggcccccgagactacgaggaccacctgtacgtcaacacgcagggtctggacggccccgag
ccgctgcagcccgaggacagcccccagagggacctgttcgacatgcgtgctcggtcagtg
ctgcccagttcagagggaccctttgaggacgccctgaggctgcatgagtgctccgttgcg
gcgggcactgcggcagcccccctcccggtggaggaccagtggcccagccccccgacccgc
cgagcccccatcgcccccaccgaggagcagctgcggcaggagccctggtaccacggccag
atgagccgtcgggcggccgagaaactgcttcgagccgacggggacttcctcgtgcgcgac
agtgtcaccaaccccggacagtacgtcctcactggcatgcacgcggggcagcccaagcac
ctgctgctggtggaccctgagggcgtggtaaggtgcggaccaaggatgcactgttcgaaa
gcatcagccacctggtcgactaccacctgcagcacgggcagcccatcgtggccgcgggga
gcgagctgcacctgcgcggcgcggtcaagcgggagccctgagccaggtggtgattctcag
cccgcgggtcctggccctgctccccgatgcccctgtcgtggccttaggggctcctcagcc
tttgtctggaccctggttgggcctgaaccaccgctgtctctccttcctctgcgtgggtct
ctggaatcttccttctccaggtggccctga

KEGG   Camelus ferus (Wild Bactrian camel): 102508169
Entry
102508169         CDS       T02979                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04510  Focal adhesion
cfr04650  Natural killer cell mediated cytotoxicity
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04935  Growth hormone synthesis, secretion and action
cfr05034  Alcoholism
cfr05100  Bacterial invasion of epithelial cells
cfr05214  Glioma
cfr05220  Chronic myeloid leukemia
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102508169 (SHC3)
   04014 Ras signaling pathway
    102508169 (SHC3)
   04072 Phospholipase D signaling pathway
    102508169 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102508169 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102508169 (SHC3)
   04062 Chemokine signaling pathway
    102508169 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102508169 (SHC3)
   04915 Estrogen signaling pathway
    102508169 (SHC3)
   04917 Prolactin signaling pathway
    102508169 (SHC3)
   04926 Relaxin signaling pathway
    102508169 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    102508169 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102508169 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102508169 (SHC3)
   05226 Gastric cancer
    102508169 (SHC3)
   05214 Glioma
    102508169 (SHC3)
   05220 Chronic myeloid leukemia
    102508169 (SHC3)
   05224 Breast cancer
    102508169 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    102508169 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102508169 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102508169 (SHC3)
   01522 Endocrine resistance
    102508169 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 102508169
NCBI-ProteinID: XP_032327011
LinkDB
Position
31
AA seq 588 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGKVSAARAAPAAAPYLVSGDALRRAPEDGP
GSLGHLLHKVSHLKLSSSGLRGLSAARERAGARLSGSCSAPSLAAPDGSAPPGPRAPAMR
AARQGRPGDEPPPCAPHASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRRRKPPSKMLSSILGKRNLQFAGTSISLTISTASLSLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFK
QYLQCPSKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKTPPPGGFVDARLKARPHG
PDVAQFAGKEQTYYQGRHLGDPFGEDWQQAPARQGALDIYSVPAGRSPVATAGEAPAYVN
TQRAPRQARPAAGSSAESSPRRDLFDMKPFEDALKNQPLGPVLSKAASVECISPVSPRAP
DARMLEELRAEPWYQGEMSRKEAERLLKTDGDFLVRKSATNPGSFVLTGMHNGQAKHLLL
VDPEGTIRTKDRIFDSISHLITHHLENSLPIVSAGSELCLQQPVGRNP
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctgcacaacctgtcggtgagcggcggcggcaaggtctcggcggcgcgcgcggccccg
gcggcggccccctacctggtgtccggagacgcgctgcgcagggcgcccgaagatgggccg
ggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggcctc
cgcggcctgtcggcggccagggagcgggcgggcgcgcggctctcgggcagctgcagcgcg
cccagcctggccgccccggacggcagcgcgccccccgggccccgcgccccggccatgcgc
gccgcccgccagggccgccccggcgacgagccgccgccctgcgccccgcacgccagcgac
caggtgctgggggccggagtcacctacgtcgtcaagtacttggggtgcatcgaagttctg
cgctccatgaggtcgctggacttcagcaccaggacgcagattaccagagaagccatcagc
cgggtctgcgaagccgtgcccggggccaagggagccttcaggaggagaaagcctccgagc
aaaatgctgtccagcatcctgggcaagaggaacctccagttcgcggggacgagcatctcc
ctgaccatatccaccgccagcctgagcctgcggacgccggactcgaagcagatcatagcc
aatcatcacatgcagtccatctccttcgcctccgggggggacccggacacaacagactac
gttgcgtacgtcgctaaggaccccgttaaccgcagagcctgtcacattctggagtgctgt
gacgggctggcccaggatgtcatcggctccatcggacaggcctttgagctccggttcaag
cagtatttgcagtgtccttccaagatccctgctctccacgaccgaatgcagagtctagat
gagccatggactgaagaggagggtgacggctcagaccacccgtactacaacagcattcca
agcaagacgcctcctccaggggggtttgtggatgctagactgaaagccagaccccacggc
cctgacgtggcccagtttgcagggaaagaacagacttactaccaggggagacacttagga
gacccgtttggagaagactggcagcaagcacctgccaggcaaggggccttggacatctac
agcgtgccagccgggagatcgcccgtggccaccgccggagaggcccccgcctacgtcaac
acgcagcgcgccccgcggcaggcccggccggccgccggcagcagcgcagagagcagcccc
aggagagacctcttcgatatgaagcctttcgaagacgctctcaagaaccagccgttgggg
cctgtgctgagtaaggcggcctccgtggagtgtatcagccccgtctcacccagggccccg
gatgccaggatgctggaagagctgagagcggagccttggtaccagggggagatgagcagg
aaggaggcagagcggctgctgaagacggatggagacttcctggtcaggaagagcgccacc
aaccccggctccttcgtcctcactggcatgcacaacggccaggccaagcacctgctgctc
gtggacccagaaggcacgatccggacaaaggacaggatctttgacagcatcagccacctc
atcacccaccacctggagaacagcctgcccatcgtctccgccgggagcgagctctgcctc
cagcagccggtgggaaggaacccgtga

KEGG   Camelus ferus (Wild Bactrian camel): 102517753
Entry
102517753         CDS       T02979                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04510  Focal adhesion
cfr04650  Natural killer cell mediated cytotoxicity
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04935  Growth hormone synthesis, secretion and action
cfr05034  Alcoholism
cfr05100  Bacterial invasion of epithelial cells
cfr05206  MicroRNAs in cancer
cfr05214  Glioma
cfr05220  Chronic myeloid leukemia
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102517753 (SHC4)
   04014 Ras signaling pathway
    102517753 (SHC4)
   04072 Phospholipase D signaling pathway
    102517753 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102517753 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102517753 (SHC4)
   04062 Chemokine signaling pathway
    102517753 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102517753 (SHC4)
   04915 Estrogen signaling pathway
    102517753 (SHC4)
   04917 Prolactin signaling pathway
    102517753 (SHC4)
   04926 Relaxin signaling pathway
    102517753 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    102517753 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102517753 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102517753 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102517753 (SHC4)
   05226 Gastric cancer
    102517753 (SHC4)
   05214 Glioma
    102517753 (SHC4)
   05220 Chronic myeloid leukemia
    102517753 (SHC4)
   05224 Breast cancer
    102517753 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    102517753 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102517753 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102517753 (SHC4)
   01522 Endocrine resistance
    102517753 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 102517753
NCBI-ProteinID: XP_006192384
LinkDB
Position
6
AA seq 630 aa
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGASAGNKGSPQPPY
PALAPHLPAEDATSASQESPTPLCTLIPRMASVKLANPSTLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLNRTGPAPLPQQDSVGHRATSLTPDAHPLPGPGEPTPGSRQDRH
LLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGKRTQVTREAISRLCEAVPGANGAIKKRK
PPAKFLSTVLGKSNLQFSGMNVKLTISTCSLTLMNLDNRQIIANHHMQSISFASGGDPDT
TDFVAYVAKDPVNQRACHILECRSGTAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
HVDGHAEERGDHEYYNEIPGKQPPAGGVSDVRIQVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRATGSAHERGVQSQREASLRKHTCRVDLFDDPSYINTQGLQSTLVSAGN
QSSAHPLGSPWHHEKAPETVQPGATAQPASTHSLPLIKQQLRSEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPGLLHSSK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtcaggacagcctggcaggactcgtgctgtatgtaggactctttggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacatcc
cttgacgaaggcagccccggagcctccgccgggaacaagggctcgccgcagcctccctac
ccggccctggcacctcacctgccggctgaagatgccacctcggcgtcccaggagagcccc
accccactgtgcaccttgatccctcgcatggccagtgtaaagctggccaacccatccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtacctcggctgaagctccaa
gaaagccaggacccggcccccagcagcccagcttcccctgaaaccagtctgaacaggact
ggaccagcacctctgcctcagcaggactcggtggggcacagggcgacctctttaactcct
gatgcccacccccttcctggtcctggggagccaacccctgggagcaggcaggacaggcac
cttctgcagcacctgctggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaaagagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggccaatggagccattaaaaagcgcaag
cctccagccaagtttctatcaacagttcttggcaaaagtaatcttcagttctcgggaatg
aacgtaaagctgaccatctccacgtgcagcctcacactgatgaaccttgacaaccgacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggagatcctgatacc
acagactttgttgcctacgtagctaaagatccagttaaccaacgagcctgccacatattg
gagtgccgcagtggaacggcccaagacgtcataagtaccatagggcaggccttcgaactc
cggttcaaacagtatttgaaaaatccttctttgaatacgtcttgtgaaagtgaggaggtg
catgttgatggccatgccgaggagagaggggatcatgagtattacaatgaaatcccaggg
aagcagccacctgctggtggtgtttcagatgtgcggatccaagttcaagccacagaacaa
atggcttactgtcccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggccacgggtagtgcacatgagaga
ggggtgcagtcccaacgagaggcgtcactgaggaagcacacgtgtcgagtggatctcttc
gacgacccctcctacattaatacgcagggtcttcaaagcacacttgtctctgccggaaat
caaagctcagctcacccactggggagcccgtggcaccatgaaaaggcaccagaaactgtt
cagccaggtgccacggcccagcctgccagcacgcattctctgccactcattaaacagcaa
ctgcggagtgaagactgctaccacggcaagctgagcaggaaagcggcagagagcctcttg
gtaaaggacggggacttcctggttcgagagagtgcaacatctcctggccagtatgtgctg
agtgggctccagggaggccaggcaaaacatcttctcctggtggaccctgaaggcaaggtg
aggaccaaggatcatgtatttgataatgtgggccaccttatcagataccatatggataat
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
aataatccaggacttttgcattccagcaaatga

KEGG   Camelus ferus (Wild Bactrian camel): 102524489
Entry
102524489         CDS       T02979                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04510  Focal adhesion
cfr04650  Natural killer cell mediated cytotoxicity
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04935  Growth hormone synthesis, secretion and action
cfr05034  Alcoholism
cfr05100  Bacterial invasion of epithelial cells
cfr05206  MicroRNAs in cancer
cfr05214  Glioma
cfr05220  Chronic myeloid leukemia
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102524489 (SHC1)
   04014 Ras signaling pathway
    102524489 (SHC1)
   04072 Phospholipase D signaling pathway
    102524489 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102524489 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102524489 (SHC1)
   04062 Chemokine signaling pathway
    102524489 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102524489 (SHC1)
   04915 Estrogen signaling pathway
    102524489 (SHC1)
   04917 Prolactin signaling pathway
    102524489 (SHC1)
   04926 Relaxin signaling pathway
    102524489 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    102524489 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102524489 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102524489 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102524489 (SHC1)
   05226 Gastric cancer
    102524489 (SHC1)
   05214 Glioma
    102524489 (SHC1)
   05220 Chronic myeloid leukemia
    102524489 (SHC1)
   05224 Breast cancer
    102524489 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    102524489 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102524489 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102524489 (SHC1)
   01522 Endocrine resistance
    102524489 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 102524489
NCBI-ProteinID: XP_006177294
LinkDB
Position
21
AA seq 584 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPMLPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGIVGAAILDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAPPGAARPPPPSAQTPSHLGATLPVGQPVGGDPEVRKQMLPPPPCPAGR
ELFDDPSYVNVQNLDKARQAGGGAGPPHPAINGSAPRDLFDMKPFEDALRVPPPPQSVAM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKV
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcagggtctaccccaccggaggagctgccttccccgtctgcctca
tccctggggcccatgctgccacctctgcctggggatgacagtcccactactctgtgctcc
ttcttcccccggatgagcaacctcaagctggccaacccggctggggggcgtccagggccg
aagggggagccaggaagggcagccgaggatggggaggggatcgttggggcagccatcctg
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacacggggctggctgcatcccaacgacaaagtcatgggaccgggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgcccttgac
ttcaatacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccactcagctccatcctt
ggaaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatccatc
tcgtttgcatccggcggggacccggacacagctgagtatgttgcctatgttgccaaagac
ccggtgaatcagagagcctgccacatcctggaatgtccagaagggctcgctcaggacgtt
atcagcaccattggccaggcctttgagttgcgcttcaaacaatacctcaggaacccgccc
aagctggtcaccccccatgacaggatggctggctttgatggctcagcgtgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccctctt
gggggggtggtggacatgaggcttcgagaaggagccccaccgggggctgctcgaccccct
ccacccagtgcccagactcccagccacctgggagctactctgcctgtggggcagcctgtc
gggggagaccctgaagtccgcaaacagatgctgcctccaccaccctgtccagcaggcaga
gaactctttgatgatccctcctatgtcaacgtccagaacctagacaaggctcggcaagca
gggggcggggccgggcccccccatcctgccatcaatggcagtgctcctcgagacctcttt
gacatgaagccctttgaagatgcccttcgggtgcctccacctccccagtcggtggccatg
gctgagcagctccgaggggagccctggttccacgggaagctgagccgacgggaggccgag
gcactgctgcagctcaatggggacttcctggtgcgggaaagcacgaccacacctggccag
tacgtgctcactggcttgcagagtgggcagcccaagcacctgctgctggtggaccctgag
ggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcacctcatcagctaccac
atggacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcagcctgtg
gagcggaaagtctga

DBGET integrated database retrieval system