KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386141
Entry
100386141         CDS       T03264                                 

Gene name
IL21
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386141 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386141 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100386141 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100386141 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386141 (IL21)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386141 (IL21)
SSDB
Motif
Pfam: IL15 zf-IS66 DUF678
Other DBs
NCBI-GeneID: 100386141
NCBI-ProteinID: XP_002745477
Ensembl: ENSCJAG00000002755
UniProt: F7I3A3
LinkDB
Position
3
AA seq 162 aa
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGDNERIINVSIKKLKRKPPSTKVERRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKMIHRHLSSRTHGSEDS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggatagtcatctgtctgatggtcatcttcttg
ggtacattggtccataaatcaagctctcaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggaccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcatgttttcag
aaggcccaactaaagtccgcaaatacaggagacaatgaaaggataatcaatgtatcaatt
aaaaagctgaagaggaaaccaccttccacgaaagtagagagaagacagaaacacagacta
acatgcccttcgtgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaagatgatacatcgacatctctcctctagaacacatggaagtgaa
gattcctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386149
Entry
100386149         CDS       T03264                                 

Gene name
IL10, CSIF, IL-10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04068  FoxO signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05133  Pertussis
cjc05135  Yersinia infection
cjc05140  Leishmaniasis
cjc05142  Chagas disease
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease
cjc05322  Systemic lupus erythematosus
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386149 (IL10)
   04068 FoxO signaling pathway
    100386149 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386149 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100386149 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100386149 (IL10)
   04660 T cell receptor signaling pathway
    100386149 (IL10)
   04672 Intestinal immune network for IgA production
    100386149 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100386149 (IL10)
   05322 Systemic lupus erythematosus
    100386149 (IL10)
   05320 Autoimmune thyroid disease
    100386149 (IL10)
   05321 Inflammatory bowel disease
    100386149 (IL10)
   05330 Allograft rejection
    100386149 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100386149 (IL10)
   05133 Pertussis
    100386149 (IL10)
   05150 Staphylococcus aureus infection
    100386149 (IL10)
   05152 Tuberculosis
    100386149 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100386149 (IL10)
   05144 Malaria
    100386149 (IL10)
   05145 Toxoplasmosis
    100386149 (IL10)
   05140 Leishmaniasis
    100386149 (IL10)
   05142 Chagas disease
    100386149 (IL10)
   05143 African trypanosomiasis
    100386149 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386149 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100386149 (IL10)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386149 (IL10)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100386149 (IL10)
SSDB
Motif
Pfam: IL10 IL22 2_5_RNA_ligase2
Other DBs
NCBI-GeneID: 100386149
NCBI-ProteinID: XP_002760779
Ensembl: ENSCJAG00000018536
UniProt: Q0Z972
LinkDB
Position
19
AA seq 178 aa
MHSSALLCCLVFLTGVRASPGQGTQSENSCTHFPGSLPHMLRELRVAFSRVKTFFQKKDQ
LDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFR
LRLRRCHRFLPCENKSKAVVQVKNAVSKLQEKGIYKAMSEFDIFIDYIEAYMTMKAQN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagctctgctctgttgcctggtcttcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccactttccaggcagcctgcctcacatg
cttcgagagctccgagttgccttcagcagagtgaagactttctttcaaaagaaggatcag
ctggacagcatgctgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
catgacccagacatcaaggagcacgtgaactctctgggggaaaagctgaagaccttcagg
ctgaggctgcgacgctgtcatcgatttcttccctgtgaaaacaagagcaaggcagtggtg
caggtgaagaatgctgttagtaagctccaagagaaaggtatctacaaagccatgagtgag
tttgacatcttcatcgactacatagaagcctacatgacaatgaaagcacaaaactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386502
Entry
100386502         CDS       T03264                                 

Gene name
IL19
Definition
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386502 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386502 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100386502 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386502 (IL19)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386502 (IL19)
SSDB
Motif
Pfam: IL10 MIF4G DUF3828
Other DBs
NCBI-GeneID: 100386502
NCBI-ProteinID: XP_008983822
UniProt: A0A2R8MR56
LinkDB
Position
19
AA seq 177 aa
MKLQSVSLWLLGIILILCSVDSRSFRRCLISTDMHHIEESFQEIKKAIQAKDTFPNVTVL
STLETLQSIKPLDVCCVTKNLLAFYVDRVFKDHQEPHPKILRKISSIANSFLYMQKTLQQ
CQEQRQCHCGQEATNVTRVIHDNYDQLEVRSAAIKSLGELDVFLAWIDKNHEVTSSA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagttacagtctgtttccctctggctcctgggtataattctgattttgtgctccgtg
gacagccgtagtttcaggagatgtctgatttccacagacatgcaccatatagaagagagt
ttccaagaaatcaaaaaagccatccaagctaaggacaccttcccaaatgtcactgtcctg
tccacattggagactctgcagagcattaagcccttagatgtgtgctgtgtgaccaagaat
ctcctggcgttctatgtggacagggtgttcaaggatcatcaagagccacaccccaaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaaccttgcagcaa
tgtcaggaacaaaggcagtgtcactgtgggcaggaagccaccaatgtcaccagagtcatc
catgacaactatgatcagctggaggtccgctctgctgccattaagtccctgggagagctc
gatgtctttctagcctggattgataagaatcatgaagtaacatcctcagcttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386848
Entry
100386848         CDS       T03264                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04151  PI3K-Akt signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05135  Yersinia infection
cjc05142  Chagas disease
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386848 (IL2)
   04151 PI3K-Akt signaling pathway
    100386848 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386848 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100386848 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100386848 (IL2)
   04660 T cell receptor signaling pathway
    100386848 (IL2)
   04658 Th1 and Th2 cell differentiation
    100386848 (IL2)
   04659 Th17 cell differentiation
    100386848 (IL2)
   04672 Intestinal immune network for IgA production
    100386848 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100386848 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100386848 (IL2)
   05321 Inflammatory bowel disease
    100386848 (IL2)
   05330 Allograft rejection
    100386848 (IL2)
   05332 Graft-versus-host disease
    100386848 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100386848 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100386848 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386848 (IL2)
   05171 Coronavirus disease - COVID-19
    100386848 (IL2)
   05162 Measles
    100386848 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100386848 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386848 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100386848 (IL2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386848 (IL2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100386848 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 100386848
NCBI-ProteinID: XP_002745478
Ensembl: ENSCJAG00000002770
UniProt: Q0PIT4
LinkDB
Position
3
AA seq 154 aa
MYRMQLLSCIALSLALITNSAPTSSSTKKTQLQLEHLLLDLQMLLNGINNYKNPKLTRML
TFKFYMPKKAKELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTRDIISNINVLVLELKGS
ETTFTCEYDDDTATIIEFLNGWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcactcatcacaaacagt
gcacctacttcaagttctacaaagaagacacagctacaactggagcatttactgctggac
ttacagatgcttttgaatggaattaataattacaagaatcccaaactcacaaggatgctc
acatttaagttttacatgcccaagaaggccaaagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagacaccagggatataatcagcaatatcaatgtactagttttggaactaaagggatct
gaaacaacattcacatgtgaatatgatgatgacacagcaaccattatagaatttctgaat
ggatggattaccttttgtcaaagcatcatctcaacactgacttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386858
Entry
100386858         CDS       T03264                                 

Gene name
IL20
Definition
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386858 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386858 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100386858 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386858 (IL20)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386858 (IL20)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 100386858
NCBI-ProteinID: XP_003735305
Ensembl: ENSCJAG00000018515
LinkDB
Position
19
AA seq 176 aa
MKASGLAFGLLSAAFYLLWTPATGLKTLHLGKCVIATNLQEIRNGFLEIRGSVQAKDGNI
DVRILRRTESLQDTEPADRCCLLRHLLRLYLDRVFKNYQTPDHHTLRKISSLANSFLTVK
KDLRLCHAHMTCHCGEGATKKYSQILSHFEELEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcctctggtcttgccttcggccttctttctgctgcattttacctcctctggact
cctgccactggactgaagacactccatttgggaaagtgtgtgatcgccacaaaccttcag
gaaatacgaaatggatttttggagatacggggcagtgtgcaagccaaagatggaaacatt
gatgtcaggatcttaaggaggactgagtccttacaagacacagagccggcagatcggtgc
tgcctcctgcgccatttactaagactctatctggacagagtatttaaaaactaccagact
cctgaccatcatactctccggaagatcagcagcctcgccaattcctttcttaccgtcaag
aaggacctccggctctgtcatgcccacatgacatgccattgtggggagggagcaacgaag
aaatacagccagattctgagtcactttgaagagcttgagcctcaggcagcagttgtgaag
gctttgggagaactagacattcttctgcaatggatggaggagacagaatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387372
Entry
100387372         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100387372
   04151 PI3K-Akt signaling pathway
    100387372
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387372
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100387372
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100387372
   04621 NOD-like receptor signaling pathway
    100387372
   04622 RIG-I-like receptor signaling pathway
    100387372
   04623 Cytosolic DNA-sensing pathway
    100387372
   04650 Natural killer cell mediated cytotoxicity
    100387372
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387372
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100387372
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100387372
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100387372
   05161 Hepatitis B
    100387372
   05160 Hepatitis C
    100387372
   05171 Coronavirus disease - COVID-19
    100387372
   05164 Influenza A
    100387372
   05162 Measles
    100387372
   05168 Herpes simplex virus 1 infection
    100387372
   05163 Human cytomegalovirus infection
    100387372
   05167 Kaposi sarcoma-associated herpesvirus infection
    100387372
   05169 Epstein-Barr virus infection
    100387372
   05165 Human papillomavirus infection
    100387372
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387372
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100387372
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100387372
NCBI-ProteinID: XP_008989292
LinkDB
Position
Un
AA seq 116 aa
MALPFTILMALVMLICKSICSLGCELPQAHSLSNRRASILLAQMRRISPFSCLKDRQDLP
LKNAQSILAVRKYFERITLYLTEKKHSPCAWEVVRAEIMRSFSLLTSLQERLRRKE
NT seq 351 nt   +upstreamnt  +downstreamnt
atggccttgccttttactatattgatggccctagtcatgctcatctgcaagtccatctgc
tctctgggctgtgaactgcctcaggcccacagcctgagtaacaggagggcctccatactc
ctggcacaaatgaggagaatctctcctttctcttgcctgaaggacagacaggacttacca
ctgaagaatgcgcaatccatcctggctgtgaggaaatacttcgaaagaatcactctctat
ctgacagaaaagaaacacagcccttgtgcctgggaggttgtcagagcagaaatcatgaga
tccttctctttattgaccagcttgcaagaaagattaagaaggaaggaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387550
Entry
100387550         CDS       T03264                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04630  JAK-STAT signaling pathway
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100387550 (LIF)
   04668 TNF signaling pathway
    100387550 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387550 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100387550 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387550 (LIF)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100387550 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100387550
NCBI-ProteinID: XP_002743712
Ensembl: ENSCJAG00000010302
LinkDB
Position
1
AA seq 202 aa
MKVLAAGVVPLLLVLHWRHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKARLVELYRIVVYLGTALGNIT
RDQKILNPSALSLHSKLNTTADILRGLLSNVLCRLCSKYHVAHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIGMLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctggttctgcactggagacatggg
gcggggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctgtttattctctattacacagcccaaggcgagccattccccaacaacctggacaag
ctgtgcggccccaatgtgacggacttcccgcccttccatgccaatggcacggagaaggcc
aggctggtggagctgtaccgcatagttgtgtatctcggcaccgccctgggcaacatcacc
cgggaccagaagatcctcaaccccagcgccctcagcctccatagcaagctcaacaccact
gccgacattctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtggcccacgtggacgtgacctacggccccgacacgtcgggtaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtataagcagatcatcggcatgttggctcag
gccttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387798
Entry
100387798         CDS       T03264                                 

Gene name
IL7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100387798 (IL7)
   04151 PI3K-Akt signaling pathway
    100387798 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387798 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100387798 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387798 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387798 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387798 (IL7)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100387798 (IL7)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100387798 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 100387798
NCBI-ProteinID: XP_002759065
Ensembl: ENSCJAG00000000494
LinkDB
Position
16
AA seq 177 aa
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMISIDQLLDSMKEIGSNCL
NNEFNFLKRHLCDDNKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSQGTTVLLNCTSK
VKERKPPALGEAQPTKSLEENKALKEQKKLNDSCFLKRLLQEIKTCWNKILSGTKEH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatgatcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaactttttaaaaagacatttatgtgatgataataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttc
gatctccacttattaaaagtttcacaaggcacaacagtactgttgaactgcaccagcaag
gttaaagaaagaaaaccacctgccctgggtgaagcccaaccgacaaagagtttggaagaa
aataaagctttaaaggaacagaaaaaactgaatgactcatgtttcctaaagagactacta
caagagataaaaacttgttggaataagattttgagtggcactaaagaacactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387903
Entry
100387903         CDS       T03264                                 

Gene name
OSM
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100387903 (OSM)
   04151 PI3K-Akt signaling pathway
    100387903 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387903 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387903 (OSM)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100387903 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100387903
NCBI-ProteinID: XP_002743713
Ensembl: ENSCJAG00000010320
LinkDB
Position
1
AA seq 251 aa
MGSLLTRKTLLSLVLALLFPSTAAVGSCLKEYDVLLDQLQKQTDLMQDTSSLLDPYIRIQ
GLDVPKLREHCREHPGAFPSEEDLQGLGRRDFLQTLNATLGHVMHRLAALEQQFPKAQDL
KRSRLNTEDLEKLQMARPNVLGLRNNVYCMAQLLDISDMAKSTTAGRGTSQLPVPVLVSD
SFQHKLEGCRFLHGYHRFMHSVGRVFSKWRKSPSRSRSRRHSPWRALRKEVHRTRPSRRG
KRLMPRGQLPR
NT seq 756 nt   +upstreamnt  +downstreamnt
atggggtcactgctcacacggaaaacgctgctcagtctggtcctcgcactcctgttccca
agcactgcagctgtgggcagctgcttgaaagagtacgacgtgctcctcgaccagctccag
aagcagacggatctcatgcaggacaccagcagcctcctggacccctacatacgtatccaa
ggcctggatgttcctaaactgagagagcactgcagggagcaccctggggccttccccagc
gaggaggacctacagggcctgggcaggcgggacttcctgcagaccctcaatgccacactg
ggtcacgtcatgcacagactggctgccttagagcagcaattccccaaggcccaggacttg
aagaggtccaggctgaacaccgaggacttagagaagctgcagatggcgaggccaaatgtc
ctcgggctcaggaacaatgtctactgcatggcgcagctgctggacatctcagacatggct
aagtccaccacggctggccgggggacctcccagctgcctgtccctgtcctggtctcagat
tcttttcagcacaagctggagggctgccggtttctgcacggctaccaccgcttcatgcac
tcagtggggcgagtctttagcaagtggaggaagagcccgagccggagccggagccggaga
cacagcccctggcgggccctgcggaaggaggtacacaggaccagaccctccaggagaggc
aagagactcatgcccagggggcagctgccccggtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388391
Entry
100388391         CDS       T03264                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04668  TNF signaling pathway
cjc05135  Yersinia infection
cjc05142  Chagas disease
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100388391 (IFNB1)
   04668 TNF signaling pathway
    100388391 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100388391 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388391 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100388391 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100388391 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100388391 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100388391 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100388391 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100388391 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100388391 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100388391 (IFNB1)
   05152 Tuberculosis
    100388391 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100388391 (IFNB1)
   05161 Hepatitis B
    100388391 (IFNB1)
   05160 Hepatitis C
    100388391 (IFNB1)
   05171 Coronavirus disease - COVID-19
    100388391 (IFNB1)
   05164 Influenza A
    100388391 (IFNB1)
   05162 Measles
    100388391 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100388391 (IFNB1)
   05163 Human cytomegalovirus infection
    100388391 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100388391 (IFNB1)
   05169 Epstein-Barr virus infection
    100388391 (IFNB1)
   05165 Human papillomavirus infection
    100388391 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100388391 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100388391 (IFNB1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100388391 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100388391
NCBI-ProteinID: XP_017825037
Ensembl: ENSCJAG00000008865
LinkDB
Position
1
AA seq 213 aa
MEKGHSNCNLWKTALAQEVVGDTVSVFIMTRKCLLQIALLLCFSTTAISMSGNLLGFLQR
RSNFQSQKLLWQLNGRLEYCLKDRMNFEVPKEITQPQQLQKEDAALIIYEMLENIFTIFR
GDFSRTGWNETIVENLLANVYQHAEHLNTILKEKWEEKEFTRGKFMSTLYLKRYYGRILH
YLKAKEYSHCAWTIVRVEMLRNFYFINRLTSYL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggagaaaggacattctaactgcaacctttggaagactgctctggcacaagaggtagta
ggcgacactgtttctgttttcatcatgacccgcaagtgtctcctccaaattgctctcctg
ttgtgcttctccactacagctatttccatgagtggcaacttgcttggattcctacaaaga
agaagcaattttcagagtcagaagctcctgtggcaattgaatggaaggcttgaatattgc
ctcaaggacaggatgaactttgaggtccctaaggagatcacacaaccgcagcaactccag
aaggaggacgccgcattaatcatctatgagatgctcgagaacatctttactattttcaga
ggagacttctctaggactggctggaatgagactattgttgagaacctccttgctaatgtc
tatcagcatgcagaacatctgaacacaatcctgaaagaaaaatgggaagaaaaagaattc
accaggggaaaattcatgagcactctgtacctgaaaagatattatgggaggattctgcat
tacctgaaggccaaggagtacagccactgtgcctggaccatagtcagagtggaaatgctc
aggaacttttactttattaacagacttacaagttacctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388753
Entry
100388753         CDS       T03264                                 

Gene name
IFNW1
Definition
(RefSeq) interferon omega 1
  KO
K05440  interferon omega
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04622  RIG-I-like receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100388753 (IFNW1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388753 (IFNW1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100388753 (IFNW1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100388753 (IFNW1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100388753 (IFNW1)
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 100388753
NCBI-ProteinID: XP_008995906
Ensembl: ENSCJAG00000022637
LinkDB
Position
1
AA seq 195 aa
MAHLFPLLVALVVTSYSPVGSQACDLAQNHGQLNRNILVLLHQMRRISTFLCLKDRRNFK
FPQEMMEGSQVQKAQAMSVFHEMLQQIFNLFLIEHSSAAWNTTLLDQLHAGLHQQLAHLE
TCLVQVMGEGESAGAIRSPALTLRMYFQGIHVYLKEKKYSDCAWEVVRVEILRSLFLATN
LQERLRSKDGDLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggctcacctgttccctctgctagtggctctagtggtgaccagctatagccctgttgga
tctcaggcctgtgatctggctcagaaccatggccaacttaacaggaacatcttggtgctt
ctgcaccaaatgaggagaatctccactttcttgtgtctcaaggacagaagaaacttcaag
ttcccccaggagatgatggaaggaagccaggtgcagaaggcccaggccatgtctgttttc
catgagatgctgcagcagatcttcaacctcttcctcatagagcactcctctgctgcctgg
aacacgacccttttagaccaactccacgctggacttcatcagcaactggcacacctggag
acctgcttggtgcaggtaatgggagaaggagaatctgctggggcgattaggagccctgca
ctgaccttaaggatgtacttccagggaatccacgtctacctgaaagagaagaaatacagt
gactgtgcctgggaagttgtcagagtggaaatcttgagatccttgttcttagcaacaaac
ttgcaagaaagattaagaagtaaagatggagacctgggctcatcttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388952
Entry
100388952         CDS       T03264                                 

Gene name
IFNG, IFN-gamma, interferon
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03050  Proteasome
cjc04060  Cytokine-cytokine receptor interaction
cjc04066  HIF-1 signaling pathway
cjc04217  Necroptosis
cjc04350  TGF-beta signaling pathway
cjc04380  Osteoclast differentiation
cjc04612  Antigen processing and presentation
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05142  Chagas disease
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05321  Inflammatory bowel disease
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100388952 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100388952 (IFNG)
   04630 JAK-STAT signaling pathway
    100388952 (IFNG)
   04066 HIF-1 signaling pathway
    100388952 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388952 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100388952 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100388952 (IFNG)
   04612 Antigen processing and presentation
    100388952 (IFNG)
   04660 T cell receptor signaling pathway
    100388952 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100388952 (IFNG)
   04659 Th17 cell differentiation
    100388952 (IFNG)
   04657 IL-17 signaling pathway
    100388952 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100388952 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388952 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100388952 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100388952 (IFNG)
   05323 Rheumatoid arthritis
    100388952 (IFNG)
   05321 Inflammatory bowel disease
    100388952 (IFNG)
   05330 Allograft rejection
    100388952 (IFNG)
   05332 Graft-versus-host disease
    100388952 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100388952 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100388952 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100388952 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100388952 (IFNG)
   05164 Influenza A
    100388952 (IFNG)
   05168 Herpes simplex virus 1 infection
    100388952 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100388952 (IFNG)
   05144 Malaria
    100388952 (IFNG)
   05145 Toxoplasmosis
    100388952 (IFNG)
   05140 Leishmaniasis
    100388952 (IFNG)
   05142 Chagas disease
    100388952 (IFNG)
   05143 African trypanosomiasis
    100388952 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cjc03051]
    100388952 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100388952 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100388952 (IFNG)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100388952 (IFNG)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100388952 (IFNG)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100388952 (IFNG)
SSDB
Motif
Pfam: IFN-gamma DUF5390 Tup_N
Other DBs
NCBI-GeneID: 100388952
NCBI-ProteinID: NP_001244155
Ensembl: ENSCJAG00000007181
UniProt: B9VS86
LinkDB
Position
9
AA seq 166 aa
MKYTSYILAFQLCVVLGSLGCYCQDPYVKEAENLKKYFNAGDSDVADNGTLFLDILRTWR
EEGDRKIMQSQIISFYFKLFKNFKDNQSIQKSMETIKEDMNVKFFNSNKRKQDDFERLTN
YSVNDLNVQRKAIHELIQVMAELSPAPKIGKRKRSQTLFRGRRASQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcgtcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaacctgaagaaatattttaatgca
ggtgattcagatgtagcagataatggaactcttttcttagacattttgaggacttggaga
gaggagggtgacagaaaaataatgcagagccagattatctccttttacttcaaacttttt
aaaaactttaaagacaaccagagcatccaaaagagtatggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaggaaacaggatgactttgaaaggctgactaat
tattcggtaaacgacttgaatgtccagcgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcaccagcacctaaaatagggaagcgaaaaaggagtcagacgctgtttcga
ggtcgaagagcgtcccaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390201
Entry
100390201         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100390201
   04151 PI3K-Akt signaling pathway
    100390201
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390201
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100390201
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100390201
   04621 NOD-like receptor signaling pathway
    100390201
   04622 RIG-I-like receptor signaling pathway
    100390201
   04623 Cytosolic DNA-sensing pathway
    100390201
   04650 Natural killer cell mediated cytotoxicity
    100390201
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390201
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100390201
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100390201
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100390201
   05161 Hepatitis B
    100390201
   05160 Hepatitis C
    100390201
   05171 Coronavirus disease - COVID-19
    100390201
   05164 Influenza A
    100390201
   05162 Measles
    100390201
   05168 Herpes simplex virus 1 infection
    100390201
   05163 Human cytomegalovirus infection
    100390201
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390201
   05169 Epstein-Barr virus infection
    100390201
   05165 Human papillomavirus infection
    100390201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100390201
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100390201
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 100390201
NCBI-ProteinID: XP_002743018
UniProt: A0A2R8MXF1
LinkDB
Position
1
AA seq 189 aa
MALPFTLLMALVMLCCKAICSLGCDLPQAHSLSNRRASILLAQMRRISPFSCLKDRQDFV
FPQEVFVGDHFQKAQAIFVLHEMIQQTFNLFSTKDLSVTWDATLLDTFYTELYKQLNDLE
ACVMERIGVEGTPLMNADSILAVRKYFERITLYLTEKKHSPCAWEVVRAEIMRSFSLLTS
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttactttattgatggccctagtcatgctctgctgcaaggccatctgc
tctctgggctgtgatttgcctcaggcccacagcctgagtaacaggagggcctccatactc
ctggcacaaatgaggagaatctctcctttctcttgcctgaaggacagacaggactttgtt
ttccctcaagaggtgtttgttggtgaccacttccagaaggctcaagctatcttcgtcctc
catgagatgatccagcagaccttcaacctctttagcacaaaggacttgtccgttacttgg
gatgcaacccttttagacacattttacactgaactttacaagcagctgaatgacttggaa
gcctgtgtgatggagaggattggagtggaagggactcccctgatgaatgcggactccatc
ctggctgtgaggaaatacttcgaaagaatcactctctatctgacagaaaagaaacacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgaccagc
ctgcaagaaagattaagaaggaaggaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390490
Entry
100390490         CDS       T03264                                 

Gene name
IL11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100390490 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390490 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100390490 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100390490 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100390490 (IL11)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100390490 (IL11)
SSDB
Motif
Pfam: IL11 HTH_PafC
Other DBs
NCBI-GeneID: 100390490
NCBI-ProteinID: XP_017822805
Ensembl: ENSCJAG00000000858
LinkDB
Position
22
AA seq 120 aa
MSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRR
LQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagcgcgggggcgctgggagctctgcagctcccgggcgtgctgacacggctgcgagca
gacctgctgtcctacctgcggcacgtgcagtggctgcgccgggcgggcggctcttccctg
aagaccctggagcccgagctgggcaccctgcaggctcggctggaccggctgctgcgccgg
ctgcagctcctgatgtcccgcctggccctgccgcagccacccccagacccgccggccccc
ccactggcacccccttcctcagcctgggggggcatcagggccgcccacgccatcttgggg
gggctgcacctgacacttgactgggctgttcgggggctgctgctgctgaagacccggctg
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390925
Entry
100390925         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-14-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100390925
   04151 PI3K-Akt signaling pathway
    100390925
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390925
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100390925
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100390925
   04621 NOD-like receptor signaling pathway
    100390925
   04622 RIG-I-like receptor signaling pathway
    100390925
   04623 Cytosolic DNA-sensing pathway
    100390925
   04650 Natural killer cell mediated cytotoxicity
    100390925
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390925
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100390925
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100390925
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100390925
   05161 Hepatitis B
    100390925
   05160 Hepatitis C
    100390925
   05171 Coronavirus disease - COVID-19
    100390925
   05164 Influenza A
    100390925
   05162 Measles
    100390925
   05168 Herpes simplex virus 1 infection
    100390925
   05163 Human cytomegalovirus infection
    100390925
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390925
   05169 Epstein-Barr virus infection
    100390925
   05165 Human papillomavirus infection
    100390925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100390925
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100390925
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100390925
NCBI-ProteinID: XP_002743019
LinkDB
Position
1
AA seq 189 aa
MALTFPLLMALMVLSYKSSCSLDCNLPQTHSLGNRRTLMLLAQMRRISPLSCLKDRHDFE
FPQEEFDGNQFQKARAIFVLHEMIQQTFNLFSTKDSSAAWDETLLDKFRTELYQQLNELE
ACVMQEVGVTDTPLLNEDSTLTVKKYFQRITLYLKEKKYSACAWEVVRAEIMRSFSSSTN
LQKGLRSKK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgacctttcctttactgatggccctcatggtcctcagctacaagtcaagctgc
tctctggactgtaatctgcctcaaacccacagcctgggtaacaggagaactttgatgctc
ctggcacaaatgaggagaatctctcctttatcctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttgatggcaaccagttccagaaggctcgagccatttttgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaagactcatctgctgcttgg
gatgagaccctcctagacaaattccgcactgaactttaccagcagctgaatgaattggaa
gcctgtgtgatgcaggaggtgggggtgacagatactcccctgctgaatgaggactctact
ctgactgtgaagaaatatttccaaagaatcactctctatctgaaagagaaaaaatacagc
gcttgtgcctgggaggttgtcagagcagaaataatgagatctttttcttcatcaacaaac
ttgcaaaaaggtttaagaagtaagaaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391124
Entry
100391124         CDS       T03264                                 

Gene name
IL22
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100391124 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100391124 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100391124 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100391124 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100391124 (IL22)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100391124 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 100391124
NCBI-ProteinID: XP_009002421
Ensembl: ENSCJAG00000007195
UniProt: A0A5F4W8U7
LinkDB
Position
9
AA seq 179 aa
MTALQKSVSSFLMGSLATSYLLLLALSVQGGTAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFRGVSMSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVS
FLARLSNRLSTCHIEGDDLHIQRNVQNLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atgactgccctgcagaaatctgtgagctctttccttatggggtctctggccaccagctac
ctccttctcttggccctctcggtgcagggaggaacagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggagaaactgttc
cgcggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaactttaccctt
gaagaagtgctgctccctcagtctgataggttccagccttatatgcaggaggtggtgtcc
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaatctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgttgtttatgtctctgagaaatgcctgcatttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392730
Entry
100392730         CDS       T03264                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04622  RIG-I-like receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100392730 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100392730 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100392730 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100392730 (IFNE)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100392730 (IFNE)
SSDB
Motif
Pfam: Interferon DUF1027
Other DBs
NCBI-GeneID: 100392730
NCBI-ProteinID: XP_008995949
LinkDB
Position
1
AA seq 207 aa
MIIKHFFEILLVLLASITIFSLDLKLVLLQQRRVNQESLKLFKLQTSSIQQCLQHRKNFM
LPQKSMSSQQHXKGYTLAILHEMLQQIFSIFRADISLDGWEENHMEKFLIQLHQHLEYLE
ALMGLEAEKLSGTLGSDNLRLQVKMYFQRIHDYLENQDYSSCAWAIVRVEINRCLFFVFS
LTRKLSNQGRPLKDMEQKLTTESRSPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgatcatcaagcacttctttgaaattttgttggtgctgctggcctctatcactatcttc
tctctagatctgaaactggttcttttacagcaaagaagagtgaaccaagaaagcttaaaa
ctctttaagttgcaaacctcatcaattcagcagtgtctacaacacaggaaaaactttatg
cttcctcagaagtctatgagttctcaacagcactgaaaaggatatactctggccattctc
catgagatgcttcagcaaatcttcagcattttcagggctgatatttctctggatggctgg
gaggaaaaccacatggagaaattccttattcaacttcatcaacatctggaatacctagaa
gcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataaccttaga
ttacaagttaaaatgtacttccaaagaatccatgattacctggaaaaccaggactacagc
agctgtgcctgggccattgtccgagtagaaatcaaccgatgtctattctttgtgttcagt
ctcacaagaaagctgagcaatcaaggaagacccttgaaagacatggaacaaaagcttacc
acagagtctagaagcccagggtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393348
Entry
100393348         CDS       T03264                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin 1
  KO
K05422  cardiotrophin 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393348 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393348 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100393348 (CTF1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100393348 (CTF1)
SSDB
Motif
Pfam: pPIWI_RE_X PRF LIF_OSM
Other DBs
NCBI-GeneID: 100393348
NCBI-ProteinID: XP_009007728
LinkDB
Position
12
AA seq 152 aa
MSRREGSLEAPQADSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPG
FSPPRLPVAGLSXPAPSHAGLPVHERLRLDAAALAALPPLLDAVRRRQDELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGCRTADPRG
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagccccccaggctgactcctcagtctcactcctt
ccccacttggaggccaagatccgtcagacacacagcctcgcgcacctcctcaccaaatat
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccggc
ttctccccgccgcggttgcccgtagccggcctgagcngcccggctccgagccacgcgggg
ctgccggtgcacgagcggctgcggctggatgcggcggcgctggccgcgctgcccccgctg
ctggatgccgtgcgccgccgccaggacgagctgaacccgcgcgcgccgcgcctgctgcgc
cgcctggaggacgcggcgcgccaggcccgggccctgggcgctgcagtggaggccctgctg
gccgcgctggggtgccgcaccgcggaccccaggggctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393440
Entry
100393440         CDS       T03264                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01523  Antifolate resistance
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04659  Th17 cell differentiation
cjc04668  TNF signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05010  Alzheimer disease
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05135  Yersinia infection
cjc05142  Chagas disease
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05321  Inflammatory bowel disease
cjc05323  Rheumatoid arthritis
cjc05332  Graft-versus-host disease
cjc05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393440 (IL6)
   04668 TNF signaling pathway
    100393440 (IL6)
   04066 HIF-1 signaling pathway
    100393440 (IL6)
   04068 FoxO signaling pathway
    100393440 (IL6)
   04151 PI3K-Akt signaling pathway
    100393440 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393440 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100393440 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100393440 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100393440 (IL6)
   04620 Toll-like receptor signaling pathway
    100393440 (IL6)
   04621 NOD-like receptor signaling pathway
    100393440 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100393440 (IL6)
   04625 C-type lectin receptor signaling pathway
    100393440 (IL6)
   04659 Th17 cell differentiation
    100393440 (IL6)
   04657 IL-17 signaling pathway
    100393440 (IL6)
   04672 Intestinal immune network for IgA production
    100393440 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393440 (IL6)
   05202 Transcriptional misregulation in cancer
    100393440 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100393440 (IL6)
   05321 Inflammatory bowel disease
    100393440 (IL6)
   05332 Graft-versus-host disease
    100393440 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100393440 (IL6)
   05020 Prion disease
    100393440 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100393440 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100393440 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100393440 (IL6)
   04931 Insulin resistance
    100393440 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100393440 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100393440 (IL6)
   05135 Yersinia infection
    100393440 (IL6)
   05133 Pertussis
    100393440 (IL6)
   05134 Legionellosis
    100393440 (IL6)
   05152 Tuberculosis
    100393440 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393440 (IL6)
   05161 Hepatitis B
    100393440 (IL6)
   05171 Coronavirus disease - COVID-19
    100393440 (IL6)
   05164 Influenza A
    100393440 (IL6)
   05162 Measles
    100393440 (IL6)
   05168 Herpes simplex virus 1 infection
    100393440 (IL6)
   05163 Human cytomegalovirus infection
    100393440 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100393440 (IL6)
   05169 Epstein-Barr virus infection
    100393440 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100393440 (IL6)
   05144 Malaria
    100393440 (IL6)
   05142 Chagas disease
    100393440 (IL6)
   05143 African trypanosomiasis
    100393440 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100393440 (IL6)
   01523 Antifolate resistance
    100393440 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100393440 (IL6)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100393440 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 GCSF
Other DBs
NCBI-GeneID: 100393440
NCBI-ProteinID: NP_001254700
Ensembl: ENSCJAG00000001400
UniProt: Q0Z973
LinkDB
Position
8
AA seq 212 aa
MNSLSTSAFRPVAFSLGLLLVMPAAFPAPVPLGEDSKEVAAPNRQLLTSTERIDKHIRYI
LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL
EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQKKAKNLSAIATPDPATNASLLTKLQ
AQDQWLQGVTTHLILRSFKEFLQNSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactctctctccacaagcgccttcagaccagttgccttctccctggggctgctcctg
gtgatgcctgctgccttccctgccccagtacccctgggagaagattccaaagaggtagct
gccccaaatagacagctactcacctctacagaacgaattgacaaacacattcggtacatc
ctcgacggcatctcagccttgagaaaggagatatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggcagaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctgctgaaaatcaccactggtcttttg
gagtttgaagtatacctagagtacctccagaacaggtttgagagtagcaaggaacaagcc
ggagctgtgcagatgagtacaaaaggcctgatccagtccctgcagaaaaaggcaaagaat
ctaagtgcaatagccacccctgacccagccacaaatgccagcctgctgacgaagctgcag
gcacaggaccagtggctgcagggcgtgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagaacagtctgagggctcttcggcaaatgtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393705
Entry
100393705         CDS       T03264                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393705
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100393705
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100393705
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 100393705
NCBI-ProteinID: XP_017818877
LinkDB
Position
12
AA seq 200 aa
MPARLCLLTLLSPPLSSAAPVSPAEPISQAYSLALYMQKNTSTLLQTYLRYQGSPFSDPG
FSAPELQLSSLPPATAFFKTWHALDDGERLSLAQGAFLALTQHLQLVGDDQSDLNPGSPI
LLAQLGAARLRAQGLLGNMAAIMMALGLPIPPEEDTLGLVAFGASAFERKCRGYVVTREY
GHWTDRAVRDLALLKAKYPA
NT seq 603 nt   +upstreamnt  +downstreamnt
atgccagcccgcctctgcctgctgaccctgctgtcaccacccctcagctcggcagccccc
gtctccccggctgagcccattagtcaagcctacagcctggccctctacatgcagaagaat
acgtcaacgctgctgcagacttatctccggtaccagggcagcccttttagtgaccctggc
ttctcagcccctgagctccagctcagcagcctgcctcctgccacggccttcttcaagacc
tggcacgccctggatgatggagaacggctgagccttgcccagggggccttcctggccttg
acccagcacctccagctcgtgggggatgaccagagcgacctgaaccctggcagtcccatc
ctgctggctcagctcggggctgcgagactcagggcccaaggcctgctgggcaacatggcc
gccatcatgatggccctggggctgccgatccccccagaagaggatactctcgggcttgtt
gcctttggggcctcagcctttgagaggaaatgtcgaggctacgtggttacccgggaatat
ggccactggacagaccgtgctgtgagggacttggctctgctcaaggccaagtacccagca
tag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394339
Entry
100394339         CDS       T03264                                 

Gene name
IL24
Definition
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100394339 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100394339 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100394339 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100394339 (IL24)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100394339 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 100394339
NCBI-ProteinID: XP_017821936
LinkDB
Position
19
AA seq 247 aa
MSLGSLLALLRGKESVLWGCAWFWRVKLMLSRNKGFLLVAGLRKERTVMEEEEVQGIPSY
PALLAMASRMRMATLTCLSLLLLWIQVPGAQGQKFQFGPCQVKGVVPQKLWEAFWAVKDT
MQAQDNVTSVRLLHQEVLQNVSAAESCYLVHSLLEFYLKTVFKNYHDRTAEVRTLKSFST
LANNFILIVSQLQPSQENEMFAIRDSAHRRFLLFRRAFKQLDMEAALTKALGEVDVLLTW
MQKFYKF
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtccctaggttctctccttgcccttctcaggggaaaagagagtgtgctgtggggctgt
gcctggttctggagggtaaaactaatgctctccaggaacaaaggattcctgctggtggca
ggtttgaggaaagagagaactgtgatggaggaggaggaggtgcagggcataccttcctac
cccgctttgctggcgatggcctctcgaatgcggatggctacgctcacttgcttgagtctc
ctgcttctctggatccaggtgccaggggcccagggccaaaaattccaatttgggccctgc
caagtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaggacact
atgcaggctcaagataatgtgacgagtgtccggctgctgcatcaggaagtcctgcagaac
gtctcggctgctgagagctgttaccttgtccactccctgctggagttctacttgaaaact
gttttcaaaaactaccacgatagaacagctgaagtcaggactctgaaatcattctccact
ctggccaacaacttcattctcatcgtgtcacaactgcaacccagtcaggaaaatgagatg
tttgccatcagagacagcgcacacaggcggtttctgctattccggagagcatttaaacag
ttggacatggaagcagctctgaccaaagcccttggggaagtggatgttcttctgacctgg
atgcagaaattctacaagttctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395403
Entry
100395403         CDS       T03264                                 

Gene name
IL12B, IL-12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04620  Toll-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04940  Type I diabetes mellitus
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease
cjc05143  African trypanosomiasis
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05321  Inflammatory bowel disease
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100395403 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100395403 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100395403 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100395403 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100395403 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100395403 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395403 (IL12B)
   05205 Proteoglycans in cancer
    100395403 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100395403 (IL12B)
   05330 Allograft rejection
    100395403 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100395403 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100395403 (IL12B)
   05134 Legionellosis
    100395403 (IL12B)
   05152 Tuberculosis
    100395403 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100395403 (IL12B)
   05164 Influenza A
    100395403 (IL12B)
   05162 Measles
    100395403 (IL12B)
   05168 Herpes simplex virus 1 infection
    100395403 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100395403 (IL12B)
   05145 Toxoplasmosis
    100395403 (IL12B)
   05140 Leishmaniasis
    100395403 (IL12B)
   05142 Chagas disease
    100395403 (IL12B)
   05143 African trypanosomiasis
    100395403 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100395403 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100395403 (IL12B)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100395403 (IL12B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100395403 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_2 Ig_3 fn3 Ig_4
Other DBs
NCBI-GeneID: 100395403
NCBI-ProteinID: XP_002744154
Ensembl: ENSCJAG00000019062
LinkDB
Position
2
AA seq 328 aa
MCHQRLVISWFSLVLLASPLVAIWELKKDVYVIELDWYLDAPGEMVVITCDTPEEDGITW
TLEESSEVLGSGKNLTIQVKEFGDAGQYTCHKGGEALSHLLLLLHKKEDGVWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPRGVMCGAPVLSAERV
RADGKEYEYSVECQEDSACPAAEERLPIEVVVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRVFMDKTSATVIC
RKNASVSVQAQDRYYSSSWSEWASVPCN
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgccaccagcggctggtcatctcttggttttccctggttttgctagcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcatagaattggattggtacctggat
gcccccggagaaatggtggttatcacctgtgacacccctgaagaagatggtatcacctgg
accttggaggagagcagtgaggtcttaggctcgggcaaaaacctgaccatccaagtcaaa
gagtttggagatgctggccaatatacctgccacaaaggaggcgaggctctgagccatttg
cttctgctgcttcacaaaaaggaagacggagtttggtccaccgatatattaaaggaccag
aaagaacccaaaaataagacctttctaagatgtgaggccaagaattattctggacgtttc
acctgctggtggctgacaacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttccgacccccgaggggtgatgtgtggagcacctgtgctctctgcagagagggtc
agagcggacggcaaggagtatgagtactcggtggagtgtcaggaggacagtgcctgccca
gccgctgaggagaggctgcccattgaggtcgtggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaagcctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acatggagtacaccacattcctacttctccctgacattctgcattcaggtccagggcaag
agcaagagggaaaagaaagatagagtcttcatggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcgttagcgtgcaggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcaattag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395444
Entry
100395444         CDS       T03264                                 

Gene name
IL28B
Definition
(RefSeq) interleukin 28B (interferon, lambda 3)
  KO
K22669  interferon lambda 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100395444 (IL28B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100395444 (IL28B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100395444 (IL28B)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100395444 (IL28B)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100395444
NCBI-ProteinID: XP_017822883
Ensembl: ENSCJAG00000014061
UniProt: F7ACE6
LinkDB
Position
22
AA seq 200 aa
MKQDMSGGCMAVLVLMAAVLTVTGAVPVTRPLGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCRSRLFPRTWDLRQLQVRERLVALEAELALTLEVLEATADNDTALG
DVLDQPLHTLHHVLSQLRACVQPQPTARPRPRGRLHHWLHRLQEASKKESPGCLEASVTF
NLFRLLTRDLKCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaacaagacatgagtgggggctgcatggcagtgctggtgctgatggccgcagtgctg
accgtcactggagcagttcctgtgaccaggcccctcggggccctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtccccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcacttctgctgaaggactgcaggtgccgctcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgcctcgtggccttggaggct
gagctggccctgacgctggaggttctggaggccaccgctgacaatgacacggccttgggg
gacgtcctcgaccagccccttcacaccctgcaccacgtcctctcccagctccgggcctgt
gtccagcctcagcccacggcgaggcccaggccccggggccgcctccaccactggctgcac
cggctacaggaggcctcgaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcactcgggacctgaaatgcgtcgccagcggggacctgtgtgtc
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395801
Entry
100395801         CDS       T03264                                 

Gene name
IFNL1, IL29
Definition
(RefSeq) interferon lambda 1
  KO
K05447  interferon lambda 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100395801 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100395801 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100395801 (IFNL1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100395801 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100395801
NCBI-ProteinID: XP_003735614
Ensembl: ENSCJAG00000014071
LinkDB
Position
22
AA seq 191 aa
MAAAWIVVLVTLVLGLAVAGSVSTSKPITTGKGCHIDRYKSLPPQELASFKKARDALEES
FKLKDWNCTSPVFPRNWDLRLLQVRERLVALEAELALTLEVLEATADNDTALGDVLDQPL
HTLHHILSQLRACVQPQPTAGPRPQGRLHHWLHRLQDAPKKESPGCLEASVTFNLFRLLT
RDLHCVASGDL
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctgcagcttggatcgtggtgctggtgactttggtgctaggtttggctgtggcaggc
tctgtctccacttccaagcccatcactactgggaagggctgccacattgacaggtacaaa
tctctgccaccgcaggagctagcgagcttcaagaaggccagggatgccttggaagagtca
ttcaagctgaaagactggaattgcacctctcctgtcttccccaggaattgggacctgcgg
ctgctccaggtgagggagcgcctcgtggccttggaggctgagctggccctgacactggaa
gttctggaggccactgctgacaatgacacggccttgggggacgtcctggaccagcctctt
cacaccctgcaccacatcctctcccagctccgggcctgtgtccagcctcagcccacggca
gggcccaggccccagggtcgcctccaccattggctgcaccggctccaggatgccccgaaa
aaggagtcccctggctgcctcgaggcctctgtcaccttcaacctcttccggctcctcaca
cgggacctgcattgtgtcgccagtggtgacctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396248
Entry
100396248         CDS       T03264                                 

Gene name
IL9
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc05310  Asthma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100396248 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100396248 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100396248 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100396248 (IL9)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100396248 (IL9)
SSDB
Other DBs
NCBI-GeneID: 100396248
NCBI-ProteinID: XP_002744224
Ensembl: ENSCJAG00000005916
UniProt: F7HMS2
LinkDB
Position
2
AA seq 144 aa
MLLAMVLTSALLLCSVAGHGCPTLVGIRDINYLIDKMKEDPSSKCNCRANVTSCLCLPIP
SDNCTRPCFKEGLSQMTNTTVQTRYSLIFSRVKKSVEVLENKKCPYFSCEQPCNQTVAGN
VLTFLKSLLEVFQKEKMRGMGGKI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcttctggccatggtccttacttctgcgcttctgctgtgctccgtggccggccacggg
tgtccaacattagtgggcatcagggacatcaactacctgattgacaagatgaaggaagat
ccatcttcgaagtgcaactgcagagctaatgtgaccagttgtctctgtctgcccattcct
tctgacaactgcaccagaccatgcttcaaggaggggctgtctcagatgaccaataccaca
gtgcaaacgagatactcgctgattttcagtcgggtgaaaaaatccgttgaagtactagag
aacaagaagtgtccatatttctcctgtgaacagccatgcaaccaaaccgtggcaggcaat
gtgctgacatttctgaagagcctcctagaagttttccagaaagaaaagatgagaggaatg
ggaggcaaaatatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401829
Entry
100401829         CDS       T03264                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100401829 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100401829 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100401829 (TSLP)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100401829 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 100401829
NCBI-ProteinID: XP_002744731
Ensembl: ENSCJAG00000016274
LinkDB
Position
2
AA seq 157 aa
MKNLGQSKKEKVSFRKIFILQLVGLVLTYDFTNCDFTKIKKEYCRTILEDLLTYMIGTKS
TEFNNTIFCNNRSHCLTEIQRLTFDPTPGCAALAKELFAVRTNATLALWCPGYSETQINA
TQEMKKRKKRKVTTNKCLEQVSQLSGLWRRFIRTLRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaagaatttagggcaaagcaaaaaggagaaagtttctttcaggaaaatcttcatctta
caacttgtagggctggtgctaacttacgacttcactaactgtgactttacgaagattaaa
aaagagtattgccgtactattcttgaagacttgcttacatatatgattgggaccaaaagt
accgaattcaacaacaccatcttttgtaacaatcggtcacactgccttactgaaatccag
cgcctaaccttcgatcccacccccggctgcgcggcgctcgccaaggaactgttcgccgtg
agaactaacgctaccctagctctctggtgcccaggctattcggaaactcagataaatgct
actcaggaaatgaagaagaggaaaaaaagaaaagtcacaaccaataagtgtctggaacaa
gtctcacaattatcaggattgtggcgtcgcttcattcgaactttaaggaaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404940
Entry
100404940         CDS       T03264                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04622  RIG-I-like receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100404940 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100404940 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100404940 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100404940 (IFNK)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100404940 (IFNK)
SSDB
Motif
Pfam: Interferon CsoSCA
Other DBs
NCBI-GeneID: 100404940
NCBI-ProteinID: XP_017829475
LinkDB
Position
1
AA seq 208 aa
KKNEHKPDMSQKCLWLELLVGLFIAGTLSLDCNLLNVHLRRVTWQNLRLLSMNNSFPIEC
LRENIAFELPXEFLQYTQPMKRDMRKAFHEMSLQAFNIFSQHTFKSTEREHLKQIQIGLD
QQAEYLNQCWEEEENENEVMKEMKVDEMKPSEARVPHPSKLGLRRYFNRTDNFLKEKKSS
DCAWEIVRVEIRRCLYYFYKFTALLRSK
NT seq 627 nt   +upstreamnt  +downstreamnt
aaaaaaaatgagcacaaacctgatatgagtcaaaagtgtttgtggcttgagctccttgtg
ggtctgttcattgctggcactctgtctctggactgtaacttactgaatgttcacctgaga
agggtcacctggcaaaatctgagacttcttagtatgaacaattcatttcctatagaatgt
ctacgagaaaacatagcttttgagttgcccnaagagtttctacaatatacccagcctatg
aagagggatatgaggaaggccttccacgaaatgtccctacaggccttcaacatcttcagc
caacacaccttcaaatccaccgaaagagaacacctcaaacaaatccaaataggacttgat
cagcaagcagaatacctgaaccaatgctgggaggaagaggagaatgaaaatgaagtcatg
aaagaaatgaaagtagatgagatgaaaccctcagaagccagggtcccccacccgagcaag
ctgggactgaggagatatttcaacaggacagacaatttcctgaaagaaaagaaatccagt
gactgtgcctgggagattgtccgagtggaaatcagaagatgcttgtactacttttacaaa
ttcacagctctactcaggagtaaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406098
Entry
100406098         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100406098
   04151 PI3K-Akt signaling pathway
    100406098
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406098
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100406098
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100406098
   04621 NOD-like receptor signaling pathway
    100406098
   04622 RIG-I-like receptor signaling pathway
    100406098
   04623 Cytosolic DNA-sensing pathway
    100406098
   04650 Natural killer cell mediated cytotoxicity
    100406098
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406098
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100406098
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100406098
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100406098
   05161 Hepatitis B
    100406098
   05160 Hepatitis C
    100406098
   05171 Coronavirus disease - COVID-19
    100406098
   05164 Influenza A
    100406098
   05162 Measles
    100406098
   05168 Herpes simplex virus 1 infection
    100406098
   05163 Human cytomegalovirus infection
    100406098
   05167 Kaposi sarcoma-associated herpesvirus infection
    100406098
   05169 Epstein-Barr virus infection
    100406098
   05165 Human papillomavirus infection
    100406098
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406098
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100406098
SSDB
Motif
Pfam: Interferon CBF Syntaxin-6_N
Other DBs
NCBI-GeneID: 100406098
NCBI-ProteinID: XP_008988475
LinkDB
Position
1
AA seq 188 aa
MMVLPLHLLVALVVLSYKSFSSLGCDLPQNHSLGNRRALVLLAQMRRISPFSCLKDRHDF
GLPQKEFDGSQLQKARAIFVLHEMIQQTFNLFSTKDSSAAWDETLLEKFYTELYKQLNDL
EACVMERIGVEGTPLMNADSILAVRKYFQRITLYLTEKKHSPCAWEVVRAEIMRSFLFIN
QLSKKIED
NT seq 567 nt   +upstreamnt  +downstreamnt
atgatggtcttgcccttacatttactggtggcccttgtggtgctcagctacaagtcattc
agctctctgggctgtgatctgcctcagaaccacagcttgggtaacaggagggccttggtg
ctcctggcacaaatgagaagaatctctcctttctcctgcctaaaggacagacatgacttt
ggattaccccagaaggagtttgatggcagccagctccagaaggctcgagccatttttgtc
ctccatgagatgatccagcagaccttcaacctcttcagcacaaaggattcatctgctgct
tgggatgagaccctcctagaaaaattctacactgaactttacaagcagctgaatgacttg
gaagcctgtgtgatggagaggattggagtggaagggactcccctgatgaatgcggactcc
atcctggctgtgaggaaatacttccaaagaatcactctctatctgacggagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttcctcttcatcaat
caactttcgaaaaagattgaagactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406466
Entry
100406466         CDS       T03264                                 

Gene name
IFNa
Definition
(RefSeq) interferon alpha-14-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100406466 (IFNa)
   04151 PI3K-Akt signaling pathway
    100406466 (IFNa)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406466 (IFNa)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100406466 (IFNa)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100406466 (IFNa)
   04621 NOD-like receptor signaling pathway
    100406466 (IFNa)
   04622 RIG-I-like receptor signaling pathway
    100406466 (IFNa)
   04623 Cytosolic DNA-sensing pathway
    100406466 (IFNa)
   04650 Natural killer cell mediated cytotoxicity
    100406466 (IFNa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406466 (IFNa)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100406466 (IFNa)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100406466 (IFNa)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100406466 (IFNa)
   05161 Hepatitis B
    100406466 (IFNa)
   05160 Hepatitis C
    100406466 (IFNa)
   05171 Coronavirus disease - COVID-19
    100406466 (IFNa)
   05164 Influenza A
    100406466 (IFNa)
   05162 Measles
    100406466 (IFNa)
   05168 Herpes simplex virus 1 infection
    100406466 (IFNa)
   05163 Human cytomegalovirus infection
    100406466 (IFNa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100406466 (IFNa)
   05169 Epstein-Barr virus infection
    100406466 (IFNa)
   05165 Human papillomavirus infection
    100406466 (IFNa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406466 (IFNa)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100406466 (IFNa)
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100406466
NCBI-ProteinID: XP_002763552
Ensembl: ENSCJAG00000022466
LinkDB
Position
1
AA seq 189 aa
MALTFPLLMALTVLSYKSSCSLDCNLPQTHSLGNRRTLMLLAQMRRISPFSCLKDRHDFE
FPQEEFDGNQFQKARAIFVLHEIIQQTFNLFSTKDSSAAWDETLLDKFRTELYQQLNELE
ACVMQEVGVTDTPLLNEDSILTVKKYFQRITLYLKEKKYSACAWEVVRAEIMRSFSSSTN
LQKGLRSKK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgacctttcctttactgatggccctcacggtcctcagctacaagtcaagctgc
tctctggactgtaatctgcctcaaacccacagcctgggtaacaggagaactttgatgctc
ctggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttgatggcaaccagttccagaaggctcgagccatttttgtcctc
catgagataatccagcagaccttcaacctcttcagcacaaaagactcatctgctgcttgg
gatgagaccctcctagacaaattccgcactgaactttaccagcagctgaatgaattggaa
gcctgtgtgatgcaggaggtgggggtgacagatactcccctgctgaatgaggactctatc
ctgactgtgaagaaatatttccaaagaatcactctctatctgaaagagaagaaatacagc
gcttgtgcctgggaggttgtcagagcagaaataatgagatctttttcttcatcaacaaac
ttgcaaaaaggtttaagaagtaagaaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406536
Entry
100406536         CDS       T03264                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05140  Leishmaniasis
cjc05200  Pathways in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100406536 (IL4)
   04151 PI3K-Akt signaling pathway
    100406536 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406536 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100406536 (IL4)
   04660 T cell receptor signaling pathway
    100406536 (IL4)
   04658 Th1 and Th2 cell differentiation
    100406536 (IL4)
   04659 Th17 cell differentiation
    100406536 (IL4)
   04657 IL-17 signaling pathway
    100406536 (IL4)
   04664 Fc epsilon RI signaling pathway
    100406536 (IL4)
   04672 Intestinal immune network for IgA production
    100406536 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406536 (IL4)
  09163 Immune disease
   05310 Asthma
    100406536 (IL4)
   05320 Autoimmune thyroid disease
    100406536 (IL4)
   05321 Inflammatory bowel disease
    100406536 (IL4)
   05330 Allograft rejection
    100406536 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100406536 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406536 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100406536 (IL4)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406536 (IL4)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100406536 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 100406536
NCBI-ProteinID: NP_001244157
Ensembl: ENSCJAG00000013083
UniProt: A4ZXA4
LinkDB
Position
2
AA seq 151 aa
MGLTSQLLPALFFLLAWAGNFVHGHNCDIALEEIIKTLNIVTEQKTLCTKLTIMDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTHCLGATAQQLHSHKQLIRSLKRLDRNLCSLAGL
NSCPVKEADQTMLKDFLERLKMIMKEIYSKC
NT seq 456 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttcccgctctgttcttcctgttagcatgggccggcaac
tttgtccatggacacaactgcgatatcgccttagaggagatcatcaaaactttgaacatt
gtcacagagcaaaagactctgtgcaccaagttgaccataatggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcactgcctgggtgcaactgcacagcagttacacagtcac
aagcagctgatccgatccctaaaacggctggacaggaacctctgcagcctggcgggcttg
aactcctgtcctgtgaaggaagccgaccagactatgttgaaagacttcttggaaaggcta
aagatgatcatgaaagagatatattcaaagtgttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406669
Entry
100406669         CDS       T03264                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04620  Toll-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04940  Type I diabetes mellitus
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100406669 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406669 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100406669 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100406669 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100406669 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100406669 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406669 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100406669 (IL12A)
   05330 Allograft rejection
    100406669 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100406669 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100406669 (IL12A)
   05134 Legionellosis
    100406669 (IL12A)
   05152 Tuberculosis
    100406669 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100406669 (IL12A)
   05164 Influenza A
    100406669 (IL12A)
   05162 Measles
    100406669 (IL12A)
   05168 Herpes simplex virus 1 infection
    100406669 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100406669 (IL12A)
   05144 Malaria
    100406669 (IL12A)
   05145 Toxoplasmosis
    100406669 (IL12A)
   05140 Leishmaniasis
    100406669 (IL12A)
   05142 Chagas disease
    100406669 (IL12A)
   05143 African trypanosomiasis
    100406669 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406669 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100406669 (IL12A)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406669 (IL12A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100406669 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 100406669
NCBI-ProteinID: XP_008981813
Ensembl: ENSCJAG00000000431
LinkDB
Position
17
AA seq 312 aa
MPSRWKLSNACLFLTLSAANPAGRRGRTCHREADVEREREKARDQSPGKVLPRLETVIKL
WPPGSALQPPPSPAAATGLHPAARPVSLQCRPSMCPARSLLLVATLVLLDCLSLARNLPM
ATPDPGMFPCLHHSQTLLRAVSNMLQKARQTLKFYPCTSEEIDHEDITKDKTSTVEACLP
LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKAMNAKLLM
DPKRQIFLDQNMLAVIDKLMQALNFNSETVPQKSSLEEPDFYRTKTKLCILLHAFRIRAV
TIDRVISYLHVA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgccatcccgctggaagctgtccaatgcctgcttgtttttaacactcagcgccgcaaac
cccgcgggccggcggggccgcacgtgtcaccgagaagctgatgtagagagagagagagag
aaagcaagagaccagagtcccgggaaagtcctgccgcgcctcgagacagttataaaattg
tggccccctgggtcagccttgcagccacctccctcacctgccgcggccacaggtctgcat
ccagcggctcgcccagtgtccctgcagtgccggcccagcatgtgtccagcgcgcagcctc
ctccttgtggccactctggtcctcctggactgcctcagcttggccagaaacctccccatg
gccaccccagacccaggaatgttcccgtgccttcaccactcccaaaccctgctaagggcc
gtcagcaacatgctccagaaggccagacaaactctaaaattttacccttgcacttctgaa
gagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgcttacca
ttggaattaaccaagaatgagagttgcctaaattccagagagacctcttttataactaac
gggagttgcctggcctccagaaaaacctcttttatgatggccctgtgccttagtagtatt
tatgaagacttgaagatgtaccaggtggagttcaaggccatgaatgcaaagcttctgatg
gatcctaagaggcagatctttctagatcaaaacatgctggcagttattgacaagctgatg
caggccctgaatttcaacagtgagactgtgccacaaaagtcctcccttgaagaaccggat
ttttatagaactaaaaccaagctctgcatacttcttcatgctttcagaattcgggcagtg
accattgatagagtgataagctatctgcatgttgcctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406899
Entry
100406899         CDS       T03264                                 

Gene name
IL13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04664  Fc epsilon RI signaling pathway
cjc05200  Pathways in cancer
cjc05310  Asthma
cjc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100406899 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406899 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100406899 (IL13)
   04657 IL-17 signaling pathway
    100406899 (IL13)
   04664 Fc epsilon RI signaling pathway
    100406899 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406899 (IL13)
  09163 Immune disease
   05310 Asthma
    100406899 (IL13)
   05321 Inflammatory bowel disease
    100406899 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406899 (IL13)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406899 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 100406899
NCBI-ProteinID: NP_001254683
Ensembl: ENSCJAG00000013071
UniProt: B0KWP3
LinkDB
Position
2
AA seq 132 aa
MALWLTMVIALTCLGGLASPGPVPPYTALKELIEELVNITQNQKAPLCNGSMVWSINMTA
GVYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLLVRDTKIEVAQFVKDLLR
HLRKLFHQGTFN
NT seq 399 nt   +upstreamnt  +downstreamnt
atggcgctttggttgaccatggtcattgctctcacttgcctcggcggccttgcctcccca
ggccccgtgcctccctatacagccctcaaggagctcattgaagagctggtcaacatcacc
cagaaccagaaggcccccctctgcaatggcagcatggtgtggagcatcaacatgacagct
ggcgtgtactgtgcagccctggaatccctgatcaatgtgtcagggtgcagtgccatcgag
aagacccagaggatgctgagcggattctgcccacacaaggtctcagccgggcagttttcc
agcttgcttgtccgagacaccaaaatcgaagtggcccagtttgtaaaggacctgctcaga
catttaaggaaactttttcaccagggaacgttcaactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407630
Entry
100407630         CDS       T03264                                 

Gene name
IL5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05200  Pathways in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100407630 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100407630 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100407630 (IL5)
   04660 T cell receptor signaling pathway
    100407630 (IL5)
   04658 Th1 and Th2 cell differentiation
    100407630 (IL5)
   04657 IL-17 signaling pathway
    100407630 (IL5)
   04664 Fc epsilon RI signaling pathway
    100407630 (IL5)
   04672 Intestinal immune network for IgA production
    100407630 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407630 (IL5)
  09163 Immune disease
   05310 Asthma
    100407630 (IL5)
   05320 Autoimmune thyroid disease
    100407630 (IL5)
   05321 Inflammatory bowel disease
    100407630 (IL5)
   05330 Allograft rejection
    100407630 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100407630 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100407630 (IL5)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100407630 (IL5)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100407630 (IL5)
SSDB
Motif
Pfam: IL5 NuiA DUF1418
Other DBs
NCBI-GeneID: 100407630
NCBI-ProteinID: NP_001244162
Ensembl: ENSCJAG00000013034
UniProt: Q0Z974
LinkDB
Position
2
AA seq 134 aa
MRMLLHLSLLALGAAHVCANPTARPTSALVKETLALLSIHRPLLMVNETLRIPVPSHKNH
QLCTEEIFQGIGTLENQAVQGSDVEKLFQNLSLIKEHIDRQKKKCGQERRRVKQFLDYLQ
EFLGVINTEWIIES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaggatgcttctgcatttaagtttgctagctcttggagctgcccacgtgtgtgccaac
cccacagcacgtcccacaagtgcattggtgaaagagactttggcactgctttctatccat
cgacctctgctgatggtcaatgagaccctgaggattcctgttccttcacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagaaccaagctgtgcaa
gggagtgatgtggaaaaactattccaaaacttgtctttaataaaggaacacattgaccgc
caaaaaaaaaagtgtggacaagaaagacgaagagtaaagcaattcctagactacctgcaa
gagtttcttggtgtaatcaacacagagtggataatcgaaagttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409575
Entry
100409575         CDS       T03264                                 

Gene name
IL15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04668  TNF signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100409575 (IL15)
   04668 TNF signaling pathway
    100409575 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100409575 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100409575 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409575 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100409575 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100409575 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100409575 (IL15)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100409575 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 100409575
NCBI-ProteinID: XP_002745375
Ensembl: ENSCJAG00000002909
UniProt: A0A2R8P5W0
LinkDB
Position
3
AA seq 162 aa
MRISKPHLRSISIQSYLCLLLNSHFLTEAGIHVFILGCFSAALPKTEAIWVDVISDLRRI
QDLIQSIHIDATLYTESDIHPRCKVTAMKCFLLELQVISLESNNTNINDTIENLLILANR
SLSSNGTITESGCKECEELEEKNIKEFLQSFVHIVQMFIYTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccattcagtcctacttgtgtttactt
ctaaacagtcattttctaactgaggctggcattcatgtcttcattttgggctgttttagt
gcagcacttcctaaaacagaagccatctgggtggatgtaataagtgatttgagaagaatt
caagatcttattcaatctatacatattgatgctactttatatacggaaagtgatattcat
cccaggtgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccaacaatacaaatattaatgatacaatagaaaatcttctcatcctagcaaacaga
agtttatcttctaatgggactattacagaatctggatgcaaagaatgtgaggaattggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatctat
acttcttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410164
Entry
100410164         CDS       T03264                                 

Gene name
CSF2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc05146  Amoebiasis
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05171  Coronavirus disease - COVID-19
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100410164 (CSF2)
   04668 TNF signaling pathway
    100410164 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100410164 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100410164 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    100410164 (CSF2)
   04660 T cell receptor signaling pathway
    100410164 (CSF2)
   04657 IL-17 signaling pathway
    100410164 (CSF2)
   04664 Fc epsilon RI signaling pathway
    100410164 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100410164 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100410164 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100410164 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100410164 (CSF2)
   05171 Coronavirus disease - COVID-19
    100410164 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100410164 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100410164 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100410164 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100410164 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100410164 (CSF2)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     100410164 (CSF2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100410164 (CSF2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100410164 (CSF2)
SSDB
Motif
Pfam: GM_CSF Hormone_1
Other DBs
NCBI-GeneID: 100410164
NCBI-ProteinID: XP_002744657
Ensembl: ENSCJAG00000012924
UniProt: B0KWQ4
LinkDB
Position
2
AA seq 144 aa
MWLQNLLLLGTVAGSISAPTHLPSPDTQPSKHVNAIQEAQRLLNLSRDTAPETNETVEVV
SEMFDRQEPTCLQTRLELYKESLWGSLTKLKGLLTMIASHYKQHCPPTLETSCATKIITF
ESFKENLKDFLLAIPVDCWDPVQE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgctgctcttgggcactgtggccggcagcatctctgcacctacc
cacttgcccagccccgacacacagccctcgaagcatgtgaatgccatccaggaggcccag
cgtctcctgaacctgagtagagacactgctcctgagacaaatgaaacagtagaagtggtc
tcagaaatgtttgaccgccaggagccgacctgcctacagacccgcctggagctgtacaag
gaaagcctgtggggtagcctcaccaagctcaagggactcttgaccatgatagccagccac
tacaagcagcactgccccccaaccctggaaacttcctgtgcaaccaagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgccatccctgttgactgctgggat
ccagtccaggagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410529
Entry
100410529         CDS       T03264                                 

Gene name
IL3, IL-3, MCGF
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04630  JAK-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04664  Fc epsilon RI signaling pathway
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
cjc05310  Asthma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100410529 (IL3)
   04151 PI3K-Akt signaling pathway
    100410529 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100410529 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100410529 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100410529 (IL3)
   04664 Fc epsilon RI signaling pathway
    100410529 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410529 (IL3)
   05202 Transcriptional misregulation in cancer
    100410529 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100410529 (IL3)
  09163 Immune disease
   05310 Asthma
    100410529 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100410529 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100410529 (IL3)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100410529 (IL3)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Cytokines
   100410529 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 100410529
NCBI-ProteinID: XP_002744658
Ensembl: ENSCJAG00000012921
UniProt: Q28334 B0KWQ3
LinkDB
Position
2
AA seq 142 aa
MSHLPILLLLLLVSPGLQAAPTQTMPLKTTQVNCSNLREEIVTLLNQPPLASSNFNNLNR
EDQRILMKPNLRKPNLEAFQKAVKSLQNAAAIESNLKDLPVCLPTATNAATQHPIRIKDG
DWNDFQMKLKFYLKTLEIKQPQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgagccacctgcccatcctgctcctcctactcctggtcagccctggacttcaagctgcc
ccaacccagacaatgcccttgaagacaactcaggttaactgctctaacttgagggaggaa
attgtaacactcctaaaccagccacctttggcttcatcaaacttcaacaacttaaacagg
gaagaccaacgtattctgatgaaaccaaaccttcgaaagccaaacctggaagcattccag
aaggccgtcaagagtttacagaatgcagcagcaatcgagagcaatcttaaggatctccca
gtatgcctgcccacagccacgaatgcagccacgcaacatccaatccgtattaaggacggt
gactggaatgacttccagatgaaactgaagttctatttgaaaacccttgagattaagcag
cctcaatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412953
Entry
100412953         CDS       T03264                                 

Gene name
IL17D
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04657  IL-17 signaling pathway
cjc04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100412953 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100412953 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100412953 (IL17D)
   04659 Th17 cell differentiation
    100412953 (IL17D)
   04657 IL-17 signaling pathway
    100412953 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100412953 (IL17D)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100412953 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100412953
NCBI-ProteinID: XP_002748929
Ensembl: ENSCJAG00000004884
UniProt: F7I5Q8
LinkDB
Position
5
AA seq 202 aa
MLVAGFLLVLPPGWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRSADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCL
TGLFGEEDVRFRSAPVYMPTVVLRRTSACAGGRSVYTEAYITIPVGCTCVPEPEKDADSI
NSSIDKQGAKLLLGPNDAPAGP
NT seq 609 nt   +upstreamnt  +downstreamnt
atgcttgtggccggcttcttgctggtgctgccgccgggctgggccgcgggcgccccgagg
gcgggcaggcgcccggcgcggccgcggggctgcgctgaccggccggaggagctcctggag
cagctgtacgggcgcctggcggccggcgtgctcagcgccttccaccacacgctgcagctg
gggccgcgcgagcaggcgcgcaacgcgagctgcccggcagggggcagatccgccgaccgc
cgcttccggccgcccaccaacctgcgcagcgtgtctccctgggcctacagaatatcctac
gacccggcgaggtaccccaggtacctgcccgaagcttactgcctgtgccggggctgcctg
accgggctattcggcgaggaggacgtgcgcttccgcagcgccccggtctacatgcccacc
gtcgtcctgcgccgcacctccgcctgcgccggcggccgttcggtctacaccgaggcctac
atcaccatccccgtgggctgcacctgcgtccccgagccggagaaggacgcagacagcatc
aactccagcatcgacaaacagggcgccaagctcctgctgggccccaatgacgcgcccgct
ggcccctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413432
Entry
100413432         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100413432
   04151 PI3K-Akt signaling pathway
    100413432
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100413432
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100413432
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100413432
   04621 NOD-like receptor signaling pathway
    100413432
   04622 RIG-I-like receptor signaling pathway
    100413432
   04623 Cytosolic DNA-sensing pathway
    100413432
   04650 Natural killer cell mediated cytotoxicity
    100413432
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100413432
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100413432
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100413432
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100413432
   05161 Hepatitis B
    100413432
   05160 Hepatitis C
    100413432
   05171 Coronavirus disease - COVID-19
    100413432
   05164 Influenza A
    100413432
   05162 Measles
    100413432
   05168 Herpes simplex virus 1 infection
    100413432
   05163 Human cytomegalovirus infection
    100413432
   05167 Kaposi sarcoma-associated herpesvirus infection
    100413432
   05169 Epstein-Barr virus infection
    100413432
   05165 Human papillomavirus infection
    100413432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100413432
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100413432
SSDB
Motif
Pfam: Interferon APC1_C CBF
Other DBs
NCBI-GeneID: 100413432
NCBI-ProteinID: XP_002763517
Ensembl: ENSCJAG00000032493
LinkDB
Position
1
AA seq 189 aa
MALPFTILMALVMLICKSICSLGCDLPQAHSLSNRRASILLAQMRRISPFSCLKDRQDFV
FPQEVFFGDHFQKAQAIFILHEMIQQTFNLFSTKDSSVTWDATLLDTFYTELYKQLNYLE
ACVMQRIGVEGTPLMNADSILAVRKYFERITLYLTEKKHSPCAWEVVRAEIMRSFSLLTS
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccttttactatattgatggccctagtcatgctcatctgcaagtccatctgc
tctctgggctgtgatctgcctcaggcccacagcctgagtaacaggagggcctccatactc
ctggcacaaatgaggagaatctctcctttctcttgcctgaaggacagacaggactttgtt
ttccctcaagaggtgttttttggtgaccacttccagaaggctcaagctatcttcatcctc
catgagatgatccagcagaccttcaacctctttagcacaaaggactcgtccgttacttgg
gatgcaacccttttagacacattttacactgaactttacaagcagctgaattacttggaa
gcctgtgtgatgcagaggattggagtggaagggactcccctgatgaatgcggactctatc
ctggctgtgaggaaatacttcgaaagaatcactctctatctgacagaaaagaaacacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgaccagc
ttgcaagaaagattaagaaggaaggaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414179
Entry
100414179         CDS       T03264                                 

Gene name
IL23A
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04625  C-type lectin receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05133  Pertussis
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100414179 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100414179 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100414179 (IL23A)
   04659 Th17 cell differentiation
    100414179 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414179 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100414179 (IL23A)
   05321 Inflammatory bowel disease
    100414179 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100414179 (IL23A)
   05152 Tuberculosis
    100414179 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100414179 (IL23A)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100414179 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 100414179
NCBI-ProteinID: XP_002752654
Ensembl: ENSCJAG00000011123
UniProt: A0A2R8N533
LinkDB
Position
9
AA seq 189 aa
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCMLAWSAHPLVGHMHLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSPGPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcagg
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctctcacagaagctc
tgcatgctggcctggagtgcacatccactagtgggacacatgcatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgatccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cattgggagactcagcagattccaagccccggtcccagccagccatggcagcgcctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagctgcccgggtcttt
gcccatggagcggcaaccctgagtccctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414516
Entry
100414516         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100414516
   04151 PI3K-Akt signaling pathway
    100414516
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100414516
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100414516
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100414516
   04621 NOD-like receptor signaling pathway
    100414516
   04622 RIG-I-like receptor signaling pathway
    100414516
   04623 Cytosolic DNA-sensing pathway
    100414516
   04650 Natural killer cell mediated cytotoxicity
    100414516
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414516
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100414516
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100414516
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100414516
   05161 Hepatitis B
    100414516
   05160 Hepatitis C
    100414516
   05171 Coronavirus disease - COVID-19
    100414516
   05164 Influenza A
    100414516
   05162 Measles
    100414516
   05168 Herpes simplex virus 1 infection
    100414516
   05163 Human cytomegalovirus infection
    100414516
   05167 Kaposi sarcoma-associated herpesvirus infection
    100414516
   05169 Epstein-Barr virus infection
    100414516
   05165 Human papillomavirus infection
    100414516
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100414516
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100414516
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100414516
NCBI-ProteinID: XP_002763519
Ensembl: ENSCJAG00000022738
LinkDB
Position
1
AA seq 188 aa
MALPFPSLMALVVLSCKLSCYLTCDLPQTHSLDNRRTMMLLAQMRRIFPFSCWKDRHDFG
FPQEEFNGNQFHKAPAIFVLHEMIQQTFKLFTTEDSSAAWDKDLLDEFCTELYQQLNDLE
DCVIEERVGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRVEIMRSFSLSTNL
QERLRRKD
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgccctttccttcactgatggccctggtggtgctcagctgcaagttaagctgc
tatctgacctgtgatctgcctcagacccacagcctggataacaggaggaccatgatgctc
ctggcacaaatgaggagaatctttcctttttcctgttggaaggataggcatgactttgga
tttccccaggaggagtttaatggcaaccagtttcacaaggcaccagccatctttgtcctc
catgagatgatccagcagaccttcaaactctttaccacagaagactcatctgctgcatgg
gataaggacctcctagatgaattctgcactgaactctaccagcagctaaatgacttggaa
gactgtgtgatagaggagagggtgggagaaactcccctgatgaatgtggactccatcttg
gctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagtcct
tgtgcctgggaggttgtcagagtagaaatcatgagatccttctctttatcaacaaactta
caagaaagattaaggaggaaggattaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103793369
Entry
103793369         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103793369
   04151 PI3K-Akt signaling pathway
    103793369
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103793369
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103793369
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103793369
   04621 NOD-like receptor signaling pathway
    103793369
   04622 RIG-I-like receptor signaling pathway
    103793369
   04623 Cytosolic DNA-sensing pathway
    103793369
   04650 Natural killer cell mediated cytotoxicity
    103793369
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103793369
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103793369
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103793369
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103793369
   05161 Hepatitis B
    103793369
   05160 Hepatitis C
    103793369
   05171 Coronavirus disease - COVID-19
    103793369
   05164 Influenza A
    103793369
   05162 Measles
    103793369
   05168 Herpes simplex virus 1 infection
    103793369
   05163 Human cytomegalovirus infection
    103793369
   05167 Kaposi sarcoma-associated herpesvirus infection
    103793369
   05169 Epstein-Barr virus infection
    103793369
   05165 Human papillomavirus infection
    103793369
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    103793369
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   103793369
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 103793369
NCBI-ProteinID: XP_008995929
LinkDB
Position
1
AA seq 188 aa
MMVLPLHLLVALVVLSYKPFSSLGCDLPQNHSLGYRRALVFLAQMRRISPFSCLKDRHDF
GFPQKEFDGSQLQKAQAIFVLHEMIQQNFNLFSTKDSSAAWDETLLEKFYTELYKQLNDL
EACVMERIGVEGTPLMNADSILAVRKYFQRITLYLTEKKHSPCAWEVVRAEIMRSFLFIN
QLAKKIED
NT seq 567 nt   +upstreamnt  +downstreamnt
atgatggtcttgcccttacatttgctggtggcccttgtggttctcagctacaagccattc
agctctctgggctgtgatctgcctcagaaccacagcttgggttacaggagggccttggta
ttcctggcacaaatgagaagaatctctcctttctcttgcctgaaggacagacatgacttt
ggatttccccagaaggagtttgatggcagccagctccagaaggctcaagccatttttgtc
ctccatgagatgatccagcagaacttcaacctcttcagcacaaaggactcatctgctgct
tgggatgagaccctcctagaaaaattctacactgaactttacaagcagctgaatgacttg
gaagcctgtgtgatggagaggattggagtggaagggactcccctgatgaatgcggactcc
atcctggctgtgaggaaatacttccaaagaatcactctctatctgacggagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttcctcttcatcaat
caacttgcaaaaaagattgaagactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103793373
Entry
103793373         CDS       T03264                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103793373
   04151 PI3K-Akt signaling pathway
    103793373
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103793373
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103793373
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103793373
   04621 NOD-like receptor signaling pathway
    103793373
   04622 RIG-I-like receptor signaling pathway
    103793373
   04623 Cytosolic DNA-sensing pathway
    103793373
   04650 Natural killer cell mediated cytotoxicity
    103793373
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103793373
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103793373
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103793373
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103793373
   05161 Hepatitis B
    103793373
   05160 Hepatitis C
    103793373
   05171 Coronavirus disease - COVID-19
    103793373
   05164 Influenza A
    103793373
   05162 Measles
    103793373
   05168 Herpes simplex virus 1 infection
    103793373
   05163 Human cytomegalovirus infection
    103793373
   05167 Kaposi sarcoma-associated herpesvirus infection
    103793373
   05169 Epstein-Barr virus infection
    103793373
   05165 Human papillomavirus infection
    103793373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    103793373
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   103793373
SSDB
Motif
Pfam: Interferon CBF Syntaxin-6_N
Other DBs
NCBI-GeneID: 103793373
NCBI-ProteinID: XP_008995941
LinkDB
Position
1
AA seq 188 aa
MMVLPLHLLVALVVLSYKSFSSLGCDLPQNHSLGNRRALVLLAQMRRISPFSCLKDRHDF
GLPQKEFDGSQLQKARAIFVLHEMIQQTFNLFSTNDSSAAWDETLLEKFYTELYKQLNDL
EACVMESIGVEGTPLMNVDSILAVRKYFQRITLYLTEKKHSPCAWEVVRAEIMRSFLFIN
QLAKKIED
NT seq 567 nt   +upstreamnt  +downstreamnt
atgatggtcttgcccttacatttactggtggcccttgtggtgctcagctacaagtcattc
agctctctgggctgtgatctgcctcagaaccacagcttgggtaacaggagggccttggtg
ctcctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgacttt
ggattaccccagaaggagtttgatggcagccagctccagaaggctcgagccatttttgtc
ctccatgagatgatccagcagaccttcaacctcttcagcacaaacgattcatctgctgct
tgggatgagaccctcctagaaaaattctacactgaactttacaagcagctgaatgacttg
gaagcctgtgtgatggagagcattggagtggaagggactcccctgatgaatgtggactcc
atcctggctgtgaggaaatacttccaaagaatcactctctatctgacggagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttcctcttcatcaat
caacttgcaaaaaagattgaagactaa

DBGET integrated database retrieval system