KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386210
Entry
100386210         CDS       T03264                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04910  Insulin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386210 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100386210 (SOCS4)
   04917 Prolactin signaling pathway
    100386210 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100386210 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100386210 (SOCS4)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100386210 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 100386210
NCBI-ProteinID: XP_002753985
Ensembl: ENSCJAG00000018289
UniProt: F6QNB0
LinkDB
Position
10
AA seq 440 aa
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVNDIEKTEV
SLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRSN
VEENINCFSHTNVQPCVITTTNVSCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKAKWELDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttgttcagatgctgaaacagtgaatgatatagaaaaaactgaagtt
tctttaaggagccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaactgcaggatgctgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttctgggcttccatctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcaactaaaacgaagcaat
gtggaagaaaatataaactgtttctcacataccaacgttcagccctgtgtcataaccacc
accaacgtttcgtgtagagaaggtcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaagccaaatgggaattggatgatgaaatcctgcagttggaaaca
cctcctaaataccacacacagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaatccatgttactggggagtgatggataaatacgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagattcagcacaggaagactatttattt
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgatccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagtgcctgtatgttctttgaaccacttctatccactcct
ttaattcggactttccctttttccctgcagcatatatgcagaacggttatttgtaactgt
acaacttatgatggcatcgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacaacagtgc
tag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386814
Entry
100386814         CDS       T03264                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100386814 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100386814 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100386814 (SOCS6)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100386814 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100386814
NCBI-ProteinID: XP_002757369
Ensembl: ENSCJAG00000022864
UniProt: F7HFR5
LinkDB
Position
13
AA seq 534 aa
MKKISLKTFRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINSED
EKGGKNRSKSESLMGTLKRRLSAKQKKGKAGTPSGSCADEDTFSSSSAPIVFKDVRAQRP
IRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQPD
TACQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYC
LDSSSPMEVSAVPPQVGGRSFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPR
AGHDDVPPLSPLLPPMQNNQIQRNFGGLPGTEAHVAESMRCHLNFDPNSAPGVARVYDSV
QSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLS
FRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSA
TYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaagaaaatcagtcttaaaaccttccggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttatttgggagctgctacggtaaagatatggccagctgcgatatcaacagtgaagat
gaaaaaggcggaaaaaacagatcgaaaagcgagagcctgatgggtacgctgaaaaggcgg
ctttctgcaaaacagaagaaaggcaaggcaggcacaccctctgggagctgtgccgacgag
gacaccttctcctcctcctcagcacccatagtctttaaagacgtgagagctcagaggccg
ataaggtccacctccctccgcagccatcactacagtcccacaccgtggcctcttcggccc
acaaactccgaggagacgtgcatcaagatggaggtgagagtcaaggccttggttcactct
tccagcccgagtccagccctgaatggcgtccggaaggatttccacgacctccagcctgac
accgcgtgccaagagcaagccaattcactgaagagctcggcttcacataacggagacctg
catcttcacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactacatt
cagtatactgtgcctttagatgaggggatgtatcctttggaaggatcacgtagctattgc
ctggacagttcttctcccatggaagtctctgcggttcctcctcaagtgggagggcgctct
ttcccagaggacgagagtcaggtagaccaggacctcgttgttgccccagagatctttgtg
gatcagtcggtgaatggcttgttgattggcaccacgggagtcatgttgcagagcccgagg
gcaggtcacgatgatgtccctccactctcaccattgctacctccaatgcagaataatcaa
atccaaaggaacttcggtggactccctggcacagaggcccatgtggctgaaagtatgcgc
tgtcatttgaattttgatcctaactctgctcctggggttgcaagagtttatgactcagtg
caaagtagtggtcccatggttgtgacaagccttacagaggagctgaaaaaacttgcaaaa
caaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaacgtg
ccagatggttcttttcttgtccgggacagttctgacgaccgttatcttttaagcttgagc
tttcgttcccatggtaaaacacttcacactagaattgagcactcaaacggtaggtttagc
ttttatgaacagccagatgtggaaggacacacgtccatagttgatctaattgagcattca
atcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatctgca
acttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgctgcag
tacctatgtcgttttgtgatacgtcagtataccaggatagacttaattcagaaactgcct
ttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393834
Entry
100393834         CDS       T03264                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393834 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100393834 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100393834 (SOCS5)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100393834 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 100393834
NCBI-ProteinID: XP_002757835
Ensembl: ENSCJAG00000000673
UniProt: F7BU54
LinkDB
Position
14
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFSHEGGSHNENVDMNSNRCLSVKEKSISIGDSTPQQQSSPLR
ENVALELGLSPSRNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDATTLCLQSRRQKQRQVSGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaaatacaggtgtcagaatctcttcagt
catgagggaggaagccacaatgaaaatgtggacatgaactccaacagatgtttgtctgtc
aaagagaaaagcatcagcataggagactcaactcctcagcaacaaagcagtcccttaaga
gaaaatgttgccttagaactgggattaagcccttcaaggaattcttcaaggagaaatcaa
aattgtgccactgaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccaggaacaagacttgcacgaagagattcctactctcgacatgctccgtgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattagatactgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctatggcgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgttctctgagacagcgg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcgaaacct
ctcttttccaataaaagaaaaatccatctttctgaattaatgcttgagaaatgccctttt
cctgctggttcagatttagctcaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaagttagctcctggaatgactgaaataagtggggacagttctgcaattccacaagct
aattgtgactcagaagaggatgcaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcaggtatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgccttgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttcttgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccga
cgttacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagttttgat
gcccatgacccatgtgtatttcactcctccactgtaacaggacttttagaacattataaa
gatccaagttcatgcatgttttttgaaccgttgcttactatatcactaaataggactttt
ccttttagcctgcagtatatctgccgtgcggtaatctgcaggtgcactacgtatgatggc
attgatgggctccctctaccctcaatgttacaggattttttaaaagaatatcattataaa
caaaaagttagagttcgctggttagaacgagaaccagtcaaggcaaagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396208
Entry
100396208         CDS       T03264                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04910  Insulin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100396208 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100396208 (SOCS2)
   04917 Prolactin signaling pathway
    100396208 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    100396208 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100396208 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100396208 (SOCS2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100396208 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 100396208
NCBI-ProteinID: XP_002752901
Ensembl: ENSCJAG00000002964
UniProt: F7ICH5
LinkDB
Position
9
AA seq 198 aa
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIVCVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcggagaagggacgcggagtcagtgg
gggaccgcggggtcggcggaggagccatccccggaggcggcgcgtctggcgaaggccctg
cgagagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacgggaaattcagattggactctatcgtatgtgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcactgttcacctttatctgaccaaacctctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtactggtgccatctgggga
ttgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398838
Entry
100398838         CDS       T03264                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04380  Osteoclast differentiation
cjc04630  JAK-STAT signaling pathway
cjc04668  TNF signaling pathway
cjc04910  Insulin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease
cjc04935  Growth hormone synthesis, secretion and action
cjc05160  Hepatitis C
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100398838 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100398838 (SOCS3)
   04668 TNF signaling pathway
    100398838 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100398838 (SOCS3)
   04920 Adipocytokine signaling pathway
    100398838 (SOCS3)
   04917 Prolactin signaling pathway
    100398838 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    100398838 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100398838 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100398838 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    100398838 (SOCS3)
   04931 Insulin resistance
    100398838 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100398838 (SOCS3)
   05164 Influenza A
    100398838 (SOCS3)
   05168 Herpes simplex virus 1 infection
    100398838 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100398838 (SOCS3)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100398838 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100398838
NCBI-ProteinID: XP_002748842
Ensembl: ENSCJAG00000022289
UniProt: F7HXF7
LinkDB
Position
5
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSSPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVASLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgctgtgacgggcggcgaggcgaacctgctactc
agcgcggaacccgccggcacctttctcatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgcgaggggggc
agcttctctctgcagagcgacccccggagcacgcagcccgtgccccgcttcgactgtgtg
ctcaagctggtgcaccactacatgccaccccctggagccccctccttcccctcgtcacct
actgaaccctcctccgaggtgcctgagcagccgtctgcccagcccctccctgggagtccc
cccagaagagcctattacatctactctgggggcgagaagatcccgcttgtgttgagccgg
cctctctcctccaacgtggccagtcttcagcatctctgtcggaagactgtcaacggccac
ctggactcctatgagaaagtcacccagctgcccgggcccattcgggagttcctggaccag
tacgatgccccgctttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402275
Entry
100402275         CDS       T03264                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04380  Osteoclast differentiation
cjc04630  JAK-STAT signaling pathway
cjc04910  Insulin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04935  Growth hormone synthesis, secretion and action
cjc05145  Toxoplasmosis
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100402275 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100402275 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100402275 (SOCS1)
   04917 Prolactin signaling pathway
    100402275 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    100402275 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100402275 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100402275 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100402275 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100402275 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100402275 (SOCS1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100402275 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100402275
NCBI-ProteinID: XP_017834240
UniProt: A0A5F4W0R1
LinkDB
Position
12
AA seq 211 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSSAAPARQRPCPAAPAPVPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagcctcga
cggcggccagagccttcctcctcttcctcctcctcttccgcggcccccgcgcgccagcgg
ccgtgccccgcggccccggccccggtccccggcgacacgcatttccgcacgttccgttcg
cacgctgattaccggcgcatcacgcgcgctagcgcgctcctcgacgcctgcggcttctac
tggggtcccctgagcgtgcacggggcgcacgagcggctgcgcgcggagcccgtgggcacc
ttcttggtgcgcgacagccgccagcggaactgctttttcgccctcagcgtgaagatggct
tcgggtcccacgagtatccgcgtgcacttccaggccggccgcttccacctggacggcagc
cgggagagcttcgactgcctcttcgaactgctggagcactacgtggcggcgccgcgccgc
atgctgggtgccccgctgcgccagcgccgcgtacggccgctgcaggagctgtgccgccag
cgtatcgtggccaccgtgggccgcgagaacctggcgcgcatccccctcaacccggttctt
cgcgactacctgagctccttcccctttcagatttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100896284
Entry
100896284         CDS       T03264                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100896284 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100896284 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100896284 (SOCS7)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100896284 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 100896284
NCBI-ProteinID: XP_008995717
Ensembl: ENSCJAG00000008108
UniProt: U3CB12
LinkDB
Position
5
AA seq 578 aa
MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGE
QQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSCGGDGTSKRPSGELAA
SAASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSP
HPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIR
AAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFL
VRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSK
NGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKP
LISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggaggcggccccggag
ccgggaccctcggaactactgtgtccccggcaccgctgtgccctggaccccaaggccctg
ccgccgggcttggcgctcgagcggacctggggcccggcggctggactagaggcgcagttg
gcggctctggggctcgggcagccggcagggcccggagtcaagacggtcggtgggggttgc
tgtccgtgcccgtgcccccctcagccgccccctccgcagccccagccgcctgctgccgcc
ccgcaggccggggaggatcccacggaaacgagcgacgcgcttctagtgctggagggcttg
gaatcggaggccgagagcctggagactaacagctgctcggaagaggagctcagcagccca
ggtcgcggaggaggaggagggggcggccggcttctgctgcagcccccaggccctgaatta
cctccggtgcccttcccgctgcaggacttggtccccctggggcgcctgagtagaggggag
cagcagcagcaacctcccccgcccccgcctcctcccggccccctccggcctctagcgggc
ccttctcggaagggctccttcaaaatccgcctcagtcgcctctttcgcaccaagagctgc
aacggtggttcctgcggtggggatgggaccagcaagaggccttctggagagctggctgct
tcagctgcgagcctgacagacatgggaggttctgcgggccgggagctggacgcggggagg
aaacccaggttgacaagaacgcaaagtgccttttctccggtctccttcagccccctgttc
acaggtgaaactgtgtcgcttgtggatgtggacatttctcagcggggcctgacctctcca
caccctccaactccccctcctcctccgagaagaagcctcagcctcctagatgatatcagt
gggacgctgcctacatctgtccttgtggctccgatggggtcttccttgcagtctttcccc
ctacctccgcctcctccaccccatgccccagatgcatttccccggattgctcccatccga
gcagctgaatccctgcacagccaacccccgcagcacctccaatgtcccctctaccgacct
gactcgagcagctttgcagccagccttcgagagttggagaagtgtggttggtattggggg
ccaatgaattgggaagatgcagagatgaagctgaaagggaaaccagatggttctttcctg
gtacgagacagttctgaccctcgttacatcctgagcctcagtttccgatcacaaggtatc
acccaccacactagaatggaacactacagaggaaccttcagcctatggtgtcatcccaag
tttgaggatcgctgtcaatccgttgtagagtttattaagagagccattatgcactcgaag
aatgggaagtttctctatttcttaagatccagggttccaggactgccaccaactcccgtc
cagctgctctatccagtgtcccgattcagcaatgtcaaatccctccagcacctttgcaga
ttccggatacgacagctcgtcaggatagatcacatcccagatctcccactgcctaaacct
ctgatttcttatatccgaaaattctactactatgatcctcaggaagaggtatacctgtct
ctaaaggaagcgcagctcatttccaaacagaagcaagaggtggaaccctccacgtag

DBGET integrated database retrieval system