KEGG   Homo sapiens (human): 103Help
Entry
103               CDS       T01001                                 

Gene name
ADAR, ADAR1, AGS6, DRADA, DSH, DSRAD, G1P1, IFI-4, IFI4, K88DSRBP, P136
Definition
(RefSeq) adenosine deaminase RNA specific
  KO
K12968  double-stranded RNA-specific adenosine deaminase [EC:3.5.4.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05162  Measles
hsa05164  Influenza A
Network
nt06122  IFN signaling (viruses)
nt06169  Measles virus (MV)
  Element
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
Disease
H00290  Aicardi-Goutieres syndrome
H00880  Dyschromatosis symmetrica hereditaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    103 (ADAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    103 (ADAR)
   05164 Influenza A
    103 (ADAR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    103 (ADAR)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.37  double-stranded RNA adenine deaminase
     103 (ADAR)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    103 (ADAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deamin z-alpha dsrm DND1_DSRM TrmB HTH_15 Rrf2
Motif
Other DBs
NCBI-GeneID: 103
NCBI-ProteinID: NP_001102
OMIM: 146920
HGNC: 225
Ensembl: ENSG00000160710
Vega: OTTHUMG00000037261
Pharos: P55265(Tbio)
UniProt: P55265
LinkDB All DBs
Structure
PDB: 

Position
1q21.3
AA seq 1226 aa AA seqDB search
MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQ
TPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQ
RGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLA
KKGKLQKEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSED
LLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
EKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKR
ERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLE
NRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMP
SFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVV
INGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEKTAESQ
TPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPKFQYCVAVGAQTFPSV
SAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRKIGELV
RYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQG
KQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF
HDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLS
LKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLY
ISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVP
TWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAI
CCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILD
GTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFK
KGLKDMGYGNWISKPQEEKNFYLCPV
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcggcaggggtattccctcagcggatactacacccatccatttcaaggctat
gagcacagacagctcaggtaccagcagcctgggccaggatcttcccccagtagtttcctg
cttaagcaaatagaatttctcaaggggcagctcccagaagcaccggtgattggaaagcag
acaccgtcactgccaccttccctcccaggactccggccaaggtttccagtactacttgcc
tccagtaccagaggcaggcaagtggacatcaggggtgtccccaggggcgtgcatctcaga
agtcaggggctccagagagggttccagcatccttcaccacgtggcaggagtctgccacag
agaggtgttgattgcctttcctcacatttccaggaactgagtatctaccaagatcaggaa
caaaggatcttaaagttcctggaagagcttggggaagggaaggccaccacagcacatgat
ctgtctgggaaacttgggactccgaagaaagaaatcaatcgagttttatactccctggca
aagaagggcaagctacagaaagaggcaggaacaccccctttgtggaaaatcgcggtctcc
actcaggcttggaaccagcacagcggagtggtaagaccagacggtcatagccaaggagcc
ccaaactcagacccgagtttggaaccggaagacagaaactccacatctgtctcagaagat
cttcttgagccttttattgcagtctcagctcaggcttggaaccagcacagcggagtggta
agaccagacagtcatagccaaggatccccaaactcagacccaggtttggaacctgaagac
agcaactccacatctgccttggaagatcctcttgagtttttagacatggccgagatcaag
gagaaaatctgcgactatctcttcaatgtgtctgactcctctgccctgaatttggctaaa
aatattggccttaccaaggcccgagatataaatgctgtgctaattgacatggaaaggcag
ggggatgtctatagacaagggacaacccctcccatatggcatttgacagacaagaagcga
gagaggatgcaaatcaagagaaatacgaacagtgttcctgaaaccgctccagctgcaatc
cctgagaccaaaagaaacgcagagttcctcacctgtaatatacccacatcaaatgcctca
aataacatggtaaccacagaaaaagtggagaatgggcaggaacctgtcataaagttagaa
aacaggcaagaggccagaccagaaccagcaagactgaaaccacctgttcattacaatggc
ccctcaaaagcagggtatgttgactttgaaaatggccagtgggccacagatgacatccca
gatgacttgaatagtatccgcgcagcaccaggtgagtttcgagccatcatggagatgccc
tccttctacagtcatggcttgccacggtgttcaccctacaagaaactgacagagtgccag
ctgaagaaccccatcagcgggctgttagaatatgcccagttcgctagtcaaacctgtgag
ttcaacatgatagagcagagtggaccaccccatgaacctcgatttaaattccaggttgtc
atcaatggccgagagtttcccccagctgaagctggaagcaagaaagtggccaagcaggat
gcagctatgaaagccatgacaattctgctagaggaagccaaagccaaggacagtggaaaa
tcagaagaatcatcccactattccacagagaaagaatcagagaagactgcagagtcccag
acccccaccccttcagccacatccttcttttctgggaagagccccgtcaccacactgctt
gagtgtatgcacaaattggggaactcctgcgaattccgtctcctgtccaaagaaggccct
gcccatgaacccaagttccaatactgtgttgcagtgggagcccaaactttccccagtgtg
agtgctcccagcaagaaagtggcaaagcagatggccgcagaggaagccatgaaggccctg
catggggaggcgaccaactccatggcttctgataaccagcctgaaggtatgatctcagag
tcacttgataacttggaatccatgatgcccaacaaggtcaggaagattggcgagctcgtg
agatacctgaacaccaaccctgtgggtggccttttggagtacgcccgctcccatggcttt
gctgctgaattcaagttggtcgaccagtccggacctcctcacgagcccaagttcgtttac
caagcaaaagttgggggtcgctggttcccagccgtctgcgcacacagcaagaagcaaggc
aagcaggaagcagcagatgcggctctccgtgtcttgattggggagaacgagaaggcagaa
cgcatgggtttcacagaggtaaccccagtgacaggggccagtctcagaagaactatgctc
ctcctctcaaggtccccagaagcacagccaaagacactccctctcactggcagcaccttc
catgaccagatagccatgctgagccaccggtgcttcaacactctgactaacagcttccag
ccctccttgctcggccgcaagattctggccgccatcattatgaaaaaagactctgaggac
atgggtgtcgtcgtcagcttgggaacagggaatcgctgtgtgaaaggagattctctcagc
ctaaaaggagaaactgtcaatgactgccatgcagaaataatctcccggagaggcttcatc
aggtttctctacagtgagttaatgaaatacaactcccagactgcgaaggatagtatattt
gaacctgctaagggaggagaaaagctccaaataaaaaagactgtgtcattccatctgtat
atcagcactgctccgtgtggagatggcgccctctttgacaagtcctgcagcgaccgtgct
atggaaagcacagaatcccgccactaccctgtcttcgagaatcccaaacaaggaaagctc
cgcaccaaggtggagaacggagaaggcacaatccctgtggaatccagtgacattgtgcct
acgtgggatggcattcggctcggggagagactccgtaccatgtcctgtagtgacaaaatc
ctacgctggaacgtgctgggcctgcaaggggcactgttgacccacttcctgcagcccatt
tatctcaaatctgtcacattgggttaccttttcagccaagggcatctgacccgtgctatt
tgctgtcgtgtgacaagagatgggagtgcatttgaggatggactacgacatccctttatt
gtcaaccaccccaaggttggcagagtcagcatatatgattccaaaaggcaatccgggaag
actaaggagacaagcgtcaactggtgtctggctgatggctatgacctggagatcctggac
ggtaccagaggcactgtggatgggccacggaatgaattgtcccgggtctccaaaaagaac
atttttcttctatttaagaagctctgctccttccgttaccgcagggatctactgagactc
tcctatggtgaggccaagaaagctgcccgtgactacgagacggccaagaactacttcaaa
aaaggcctgaaggatatgggctatgggaactggattagcaaaccccaggaggaaaagaac
ttttatctctgcccagtatag

DBGET integrated database retrieval system