KEGG   Homo sapiens (human): 10787
Entry
10787             CDS       T01001                                 

Gene name
NCKAP1, HEM2, NAP1, NAP125, p125Nap1
Definition
(RefSeq) NCK associated protein 1
  KO
K05750  NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10787 (NCKAP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10787 (NCKAP1)
   05132 Salmonella infection
    10787 (NCKAP1)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 10787
NCBI-ProteinID: NP_038464
OMIM: 604891
HGNC: 7666
Ensembl: ENSG00000061676
Vega: OTTHUMG00000132623
Pharos: Q9Y2A7(Tbio)
UniProt: Q9Y2A7
LinkDB
Structure
PDB: 
3P8C 4N78

Position
2q32.1
AA seq 1128 aa
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFI
VRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVF
FDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQ
MIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTML
NPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEV
FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQ
PGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEV
FDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLS
IFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKP
GVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSI
VGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHG
EPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYE
LSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSP
AIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRN
RESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgtcgcgctcagtgctgcagcccagtcagcagaagctggcggagaagctcaccatcctc
aacgaccggggcgtcggcatgctcacccgcctctacaacatcaagaaggcatgtggagac
cccaaggcaaaaccatcctatcttatcgacaaaaacctggaatctgctgtgaaattcata
gtcagaaaattccctgctgtagaaacccgcaacaacaatcaacagcttgcacaactacag
aaagaaaaatcagagattctgaaaaatctggcattatattacttcacatttgtagatgtt
atggaatttaaggaccatgtttgtgaattgctgaatactattgacgtttgccaagtcttc
tttgatattactgtaaactttgatttaacaaagaactacttagatttaattataacctat
acaacactaatgatactgctgtctcgaattgaagaaaggaaggcaatcattggattatac
aactatgcccatgaaatgactcatggagcaagtgacagagaatacccacgccttggccag
atgattgtggattatgaaaaccctttaaagaagatgatggaagaatttgtaccccatagc
aagtctctttcagatgcactaatttctcttcaaatggtatatcctcgaaggaatctttca
gctgaccagtggagaaatgcccagttattgagcctcatcagtgcacctagtacaatgctt
aatccagcacagtccgacactatgccttgtgaatacctctctttggatgcaatggaaaag
tggattatctttggctttattttgtgccatgggatcctaaatactgacgctacagcactg
aacctttggaaactagctcttcaaagtagctcttgcctctctctctttcgggatgaagtt
ttccacattcacaaagctgcagaagacttatttgtaaacatacgaggctataataaacgt
attaatgacataagagaatgcaaggaggcagccgtgtcacatgctggttcaatgcacaga
gaaagacgcaagtttttaagatctgcactgaaggaattggctactgtcctctctgatcaa
cctggattgctaggtcccaaggcactttttgtttttatggcattatcctttgcccgtgat
gaaatcatctggctacttcgtcatgcagataacatgccaaagaagagtgcagacgacttt
atagataagcacattgctgaattaatattttacatggaagaacttagagcacatgtgagg
aaatacggacctgtaatgcagaggtattacgtgcagtacctttctggctttgatgctgtt
gtcctcaatgaactcgtgcagaatctttctgtttgccctgaagatgaatcaatcatcatg
tcctcttttgttaacactatgacttccctaagtgtaaaacaagttgaagatggggaagta
tttgatttcagaggaatgagattagattggtttaggttacaggcatatactagtgtctca
aaggcttcacttggccttgcagatcacagagaacttggaaagatgatgaatacaataatt
tttcatacaaaaatggtagattccttggtggaaatgttggtggaaacatcagatctctcc
atattttgtttttatagtcgtgcttttgagaagatgtttcaacagtgtttggagttaccc
tctcaatcaagatactcaattgcatttccactactttgcactcattttatgagttgcacg
catgaactatgtccagaagagcgacatcatattggagatcgcagtctttccttatgtaat
atgttcctagatgaaatggccaaacaagctcgaaatctcatcactgatatttgcacagaa
cagtgtacccttagtgaccagttgctacccaagcattgtgccaaaactatcagtcaagca
gtgaataagaaatcaaaaaagcagactggtaagaaaggggaacctgaaagggagaaacca
ggtgttgagagcatgaggaaaaacaggctggttgtgaccaaccttgataaattgcacact
gcactttctgagttatgcttctctataaattatgtaccaaacatggtggtatgggaacat
acctttaccccacgagaatatttgacttctcatctggaaatacgctttaccaagtcaatt
gttgggatgactatgtataatcaagccacacaggaaattgcaaaaccttcagaacttcta
acaagtgtaagagcatacatgaccgtactccagtcaatagaaaactatgtgcagattgat
attacaagagtatttaataatgtgcttcttcaacaaacacaacatttagacagtcatgga
gagccaaccattacaagtctatacacaaattggtatttggaaactttgttacgacaagtc
agcaatggccatatagcatattttcctgcaatgaaagcgtttgtgaacttacctacagaa
aatgaattaacattcaatgcagaggaatattctgacatatcagaaatgaggtcattatca
gaactactaggcccatatggtatgaagtttctaagtgaaagccttatgtggcatatttca
tcacaagttgctgaacttaagaaacttgtggtggagaatgttgatgtgttaacacaaatg
aggaccagctttgacaaaccagaccagatggctgcactgtttaaaagattatcatctgtt
gacagtgtcttgaagaggatgacaataattggtgtaattttatccttccgatcattggca
caagaagcacttagagatgtcttatcctaccacattccttttcttgtaagttcaattgaa
gattttaaggatcacattccaagggaaactgatatgaaggttgcaatgaatgtgtatgag
ttatcatcagctgccggattaccttgtgagattgatcctgcattggtcgtagctctttct
tcacaaaaatcggaaaacattagtccagaagaagagtataaaattgcctgccttctcatg
gtgtttgtggcagtttctttgccaacactggccagtaatgtgatgtctcagtacagccct
gctatagaagggcattgcaacaacatacattgcttggccaaagccatcaaccagattgct
gcagctttgtttacaattcacaaaggaagcattgaagaccgtcttaaagaatttctggcg
cttgcatcctccagtctactgaaaattggccaggagacagataaaactacaacaagaaat
agagaatctgtttatttactgctagatatgattgtacaagaatctccattccttacaatg
gatcttttggaatcttgttttccttatgtcttgctgagaaatgcataccatgctgtctac
aaacaaagtgttacatcttctgcataa

KEGG   Homo sapiens (human): 3071
Entry
3071              CDS       T01001                                 

Gene name
NCKAP1L, HEM1, IMD72
Definition
(RefSeq) NCK associated protein 1 like
  KO
K05750  NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3071 (NCKAP1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3071 (NCKAP1L)
   05132 Salmonella infection
    3071 (NCKAP1L)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 3071
NCBI-ProteinID: NP_005328
OMIM: 141180
HGNC: 4862
Ensembl: ENSG00000123338
Vega: OTTHUMG00000169843
Pharos: P55160(Tbio)
UniProt: P55160
LinkDB
Position
12q13.13-q13.2
AA seq 1127 aa
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISNPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLST
FCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK
PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRA
IVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSC
GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTG
AENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF
ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR
NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFHLN
NT seq 3384 nt   +upstreamnt  +downstreamnt
atgtctttgacatctgcttaccagcataaattagcagagaagctcactatcctgaatgat
cgcggtcagggggttctcatccgtatgtataacatcaagaagacttgttcagaccccaaa
tctaagccacctttcttactggaaaagtccatggaaccatctctcaagtatatcaacaag
aaatttcccaacatagatgtccgaaacagcacgcaacatttaggaccagtacatcgtgaa
aaagccgagataattagattcctcaccaactactaccagtcatttgtggatgtcatggaa
tttcgggatcatgtatatgaacttctcaacaccattgatgcctgccagtgccattttgat
atcaatctcaactttgatttcactcggagttacctggacttgattgtaacttacacctca
gtcattttacttctgtcacggattgaagatcggcggatactcattggcatgtacaattgt
gcccatgagatgctgcatgggcatggtgaccccagttttgcccgtctgggtcagatggtc
ttggagtatgaccaccctctgaagaagctgacagaagagtttgggcctcacacaaaggct
gtgagtggagccctcctctctttgcatttcctctttgtccgaagaaaccagggggctgag
cagtggcgcagtgcccaacttctaagcctcatcagcaaccccccagccatgattaaccct
gctaattcagatacaatggcctgtgagtatctgtctgtggaagtaatggagcgctggatt
atcattgggtttcttctttgtcatgggtgcctcaactccaatagccagtgccagaagctg
tggaagctgtgtctgcagggctccctctacatcacccttatccgtgaggatgtgctgcag
gtgcacaaagtcaccgaggacctgtttagcagtttgaaagggtatggcaagagagtggca
gacataaaggagagcaaggaacatgtaattgcaaacagtggccagtttcattgtcaacgg
cggcaatttctgcggatggcagtgaaggagctggagactgtgttggctgatgaaccggga
ctactgggtcctaaggctctttttgctttcatggccctgtccttcattcgtgatgaggtc
acctggctggttcgccacacagagaatgtcaccaagacaaagacacctgaggactatgct
gactcgagcattgcagagctacttttcttgttggaggggattaggtctctggtccgaaga
cacatcaaagtgatacagcaataccaccttcagtacttggcaagatttgatgctcttgtg
ctcagtgacatcattcagaacttgtctgtgtgtccagaggaggagtccatcatcatgtcc
tcattcgtcagtatcctctcctctctgaatctcaaacaagttgataatggagaaaaattt
gaattctcaggattgaggctggactggttccgcctacaggcatacactagcgtggctaag
gcccctctgcacctgcatgagaaccctgacttagccaaggtgatgaacctcattgtcttc
cactcccgaatgctggactccgtagaaaaattgctggtggaaacttctgatctgtctact
ttctgctttcatcttcgtatctttgagaagatgtttgccatgaccttggaggaatctgcc
atgttgcgttatgccattgctttccccctgatttgtgctcactttgtccactgcactcat
gagatgtgcccagaggagtacccccacctcaagaaccatggtcttcaccactgcaactcc
ttcctggaagagttggccaagcagaccagcaattgcgtcctggagatctgtgctgagcag
cgaaacctgagcgagcagcttctacctaagcactgtgccactacaatcagcaaagccaag
aacaagaaaaccaggaagcagaggcagactcccagaaaaggagagcccgagagggacaag
ccaggagctgagagtcaccggaagaaccgcagcattgtcaccaacatggacaagctacac
ctaaacttgacagaactggcactgacaatgaatcatgtatacagtttctccgtgtttgaa
catactatcttcccttctgagtacctcagcagccacctggaggccagactcaacagagcc
attgtgtggctggctggctacaatgccacgacccaggagatcgtacggccttctgagctg
ttggcaggagtcaaagcatacattggtttcatacagtcactggcccagtttttgggtgca
gatgcttccagagtcatccgcaacgccctcctgcagcagacacaaccactggattcctgt
ggggaacagacaatcaccacactctacacaaactggtacctggaaagtctgcttagacag
gcaagcagtgggaccatcatcctctccccagccatgcaggccttcgtcagcctgcccaga
gaaggggagcagaacttcagtgcagaggagttctctgacatctctgagatgcgggccttg
gcagaactcctgggcccctatggcatgaagttcctgagtgaaaacctgatgtggcatgtg
acctctcagattgtggagctgaagaagctggtggtggaaaacatggacatacttgttcag
atcagatccaactttagcaagccggacttgatggcttccctgctgccccagctgacaggg
gctgaaaatgtgctaaagcgcatgaccatcattggggttatcctcagtttcagggccatg
gcccaagagggacttcgggaggttttctcctcccactgcccatttcttatgggtcccatt
gagtgcttgaaggagtttgtcactccagacacagacatcaaggtgaccttgagtatcttt
gagctggcatctgctgcaggtgtgggctgtgacattgacccagccttggtggctgccatt
gctaatctgaaagctgatacttcatctcctgaggaggaatataaggtggcctgcctgctc
ttgatctttctggcagtttccctcccactccttgccactgacccttcttccttttatagc
attgagaaggatggttacaacaacaatattcattgcttgaccaaagccatcatccaggtg
tctgctgccctcttcacgctctacaacaagaacattgaaactcacctcaaggaatttctg
gtggtggcctctgtcagcctcttgcagctgggccaggagactgacaagcttaaaaccaga
aatcgagaatccatttctctgctcatgcgcttggtggtggaggagtcatccttcctgacc
ctggacatgctggagtcctgtttcccttatgtcctgcttcgaaatgcctatcgggaggtg
tctcgggccttccacctaaactga

DBGET integrated database retrieval system