KEGG   Homo sapiens (human): 1642Help
Entry
1642              CDS       T01001                                 

Gene name
DDB1, DDBA, UV-DDB1, XAP1, XPCE, XPE, XPE-BF
Definition
(RefSeq) damage specific DNA binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05161  Hepatitis B
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1642 (DDB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1642 (DDB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1642 (DDB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1642 (DDB1)
   05161 Hepatitis B
    1642 (DDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1642 (DDB1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1642 (DDB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     1642 (DDB1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1642 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      1642 (DDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MMS1_N CPSF_A Beta_propel
Motif
Other DBs
NCBI-GeneID: 1642
NCBI-ProteinID: NP_001914
OMIM: 600045
HGNC: 2717
Ensembl: ENSG00000167986
Vega: OTTHUMG00000168209
Pharos: Q16531(Tbio)
UniProt: Q16531
LinkDB All DBs
Structure
PDB: 

Position
11q12.2
AA seq 1140 aa AA seqDB search
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacaactacgtggtaacggcccagaagcccaccgccgtgaacggctgcgtgacc
ggacactttacttcggccgaagacttaaacctgttgattgccaaaaacacgagattagag
atctatgtggtcaccgccgaggggcttcggcccgtcaaagaggtgggcatgtatgggaag
attgcggtcatggagcttttcaggcccaagggggagagcaaggacctgctgtttatcttg
acagcgaagtacaatgcctgcatcctggagtataaacagagtggcgagagcattgacatc
attacgcgagcccatggcaatgtccaggaccgcattggccgcccctcagagaccggcatt
attggcatcattgaccctgagtgccggatgattggcctgcgtctctatgatggccttttc
aaggttattccactagatcgcgataataaagaactcaaggccttcaacatccgcctggag
gagctgcatgtcattgatgtcaagttcctatatggttgccaagcacctactatttgcttt
gtctaccaggaccctcaggggcggcacgtaaaaacctatgaggtgtctctccgagaaaag
gaattcaataagggcccttggaaacaggaaaatgtcgaagctgaagcttccatggtgatc
gcagtcccagagccctttgggggggccatcatcattggacaggagtcaatcacctatcac
aatggtgacaaatacctggctattgcccctcctatcatcaagcaaagcacgattgtgtgc
cacaatcgagtggaccctaatggctcaagatacctgctgggagacatggaaggccggctc
ttcatgctgcttttggagaaggaggaacagatggatggcaccgtcactctcaaggatctc
cgtgtagaactccttggagagacctctattgctgagtgcttgacataccttgataatggt
gttgtgtttgtcgggtctcgcctgggtgactcccagcttgtgaagctcaacgttgacagt
aatgaacaaggctcctatgtagtggccatggaaacctttaccaacttaggacccattgtc
gatatgtgcgtggtggacctggagaggcaggggcaggggcagctggtcacttgctctggg
gctttcaaggaaggttctttgcggatcatccggaatggaattggaatccacgagcatgcc
agcattgacttaccaggcatcaaaggattatggccactgcggtctgaccctaatcgtgag
actgatgacactttggtgctctcttttgtgggccagacaagagttctcatgttaaatgga
gaggaggtagaagaaaccgaactgatgggtttcgtggatgatcagcagactttcttctgt
ggcaacgtggctcatcagcagcttatccagatcacttcagcatcggtgaggttggtctct
caagaacccaaagctctggtcagtgaatggaaggagcctcaggccaagaacatcagtgtg
gcctcctgcaatagcagccaggtggtggtggctgtaggcagggccctctactatctgcag
atccatcctcaggagctccggcagatcagccacacagagatggaacatgaagtggcttgc
ttggacatcaccccattaggagacagcaatggactgtcccctctttgtgccattggcctc
tggacggacatctcggctcgtatcttgaagttgccctcttttgaactactgcacaaggag
atgctgggtggagagatcattcctcgctccatcctgatgaccacctttgagagtagccat
tacctcctttgtgccttgggagatggagcgcttttctactttgggctcaacattgagaca
ggtctgttgagcgaccgtaagaaggtgactttgggcacccagcccaccgtattgaggact
tttcgttctctttctaccaccaacgtctttgcttgttctgaccgccccactgtcatctat
agcagcaaccacaaattggtcttctcaaatgtcaacctcaaggaagtgaactacatgtgt
cccctcaattcagatggctatcctgacagcctggcgctggccaacaatagcaccctcacc
attggcaccatcgatgagatccagaagctgcacattcgcacagttcccctctatgagtct
ccaaggaagatctgctaccaggaagtgtcccagtgtttcggggtcctctccagccgcatt
gaagtccaagacacgagtgggggcacgacagccttgaggcccagcgctagcacccaggct
ctgtccagcagtgtaagctccagcaagctgttctccagcagcactgctcctcatgagacc
tcctttggagaagaggtggaggtgcacaacctacttatcattgaccaacacacctttgaa
gtgcttcatgcccaccagtttctgcagaatgaatatgccctcagtctggtttcctgcaag
ctgggcaaagaccccaacacttacttcattgtgggcacagcaatggtgtatcctgaagag
gcagagcccaagcagggtcgcattgtggtctttcagtattcggatggaaaactacagact
gtggctgaaaaggaagtgaaaggggccgtgtactctatggtggaatttaacgggaagctg
ttagccagcatcaatagcacggtgcggctctatgagtggacaacagagaaggagctgcgc
actgagtgcaaccactacaacaacatcatggccctctacctgaagaccaagggcgacttc
atcctggtgggcgaccttatgcgctcagtgctgctgcttgcctacaagcccatggaagga
aactttgaagagattgctcgagactttaatcccaactggatgagtgctgtggaaatcttg
gatgatgacaattttctgggggctgaaaatgcctttaacttgtttgtgtgtcaaaaggat
agcgctgccaccactgacgaggagcggcagcacctccaggaggttggtcttttccacctg
ggcgagtttgtcaatgtcttttgccacggctctctggtaatgcagaatctgggtgagact
tccacccccacacaaggctcggtgctcttcggcacggtcaacggcatgatagggctggtg
acctcactgtcagagagctggtacaacctcctgctggacatgcagaatcgactcaataaa
gtcatcaaaagtgtggggaagatcgagcactccttctggagatcctttcacaccgagcgg
aagacagaaccagccacaggtttcatcgacggtgacttgattgagagtttcctggatatt
agccgccccaagatgcaggaggtggtggcaaacctacagtatgacgatggcagcggtatg
aagcgagaggccactgcagacgacctcatcaaggttgtggaggagctaactcggatccat
tag

DBGET integrated database retrieval system