KEGG   Homo sapiens (human): 1649
Entry
1649              CDS       T01001                                 

Gene name
DDIT3, AltDDIT3, C/EBPzeta, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
Definition
(RefSeq) DNA damage inducible transcript 3
  KO
K04452  DNA damage-inducible transcript 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N01009  PERK-ATF4 signaling pathway
N01010  Mutation-caused aberrant PSEN1 to PERK-ATF4 signaling pathway
N01011  IRE1a-XBP1 signaling pathway
N01015  ATF6-mediated transcription
N01016  Mutation-caused aberrant PSEN1 to ATF6-mediated transcription
N01033  Mutation-caused aberrant SNCA to ATF6-mediated transcription
N01035  Mutation-caused aberrant SNCA to PERK-ATF4 signaling pathway
N01147  Mutation-caused aberrant SOD1 to ATF6-mediated transcription
N01149  Mutation-caused aberrant SOD1 to PERK-ATF4 signaling pathway
N01198  Scrapie conformation PrPSc to PERK-ATF4 signaling pathway
Disease
H00049  Myxoid liposarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1649 (DDIT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1649 (DDIT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1649 (DDIT3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1649 (DDIT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1649 (DDIT3)
   05012 Parkinson disease
    1649 (DDIT3)
   05014 Amyotrophic lateral sclerosis
    1649 (DDIT3)
   05020 Prion disease
    1649 (DDIT3)
   05022 Pathways of neurodegeneration - multiple diseases
    1649 (DDIT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1649 (DDIT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1649 (DDIT3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1649 (DDIT3)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 GAS ATG16 DivIC DUF5595 Fungal_TACC DASH_Spc19 CLZ bZIP_Maf AC_N NAM-associated RR_TM4-6 MAJIN Neur_chan_memb Gcd10p WDCP DUF1003 DUF5094 DUF4407 IFP_35_N CDC45
Other DBs
NCBI-GeneID: 1649
NCBI-ProteinID: NP_001181986
OMIM: 126337
HGNC: 2726
Ensembl: ENSG00000175197
Vega: OTTHUMG00000170046
Pharos: P35638(Tchem)
UniProt: P35638 Q53YD1
LinkDB
Position
12q13.3
AA seq 169 aa
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcagctgagtcattgcctttctccttcgggacactgtccagctgggagctggaagcc
tggtatgaggacctgcaagaggtcctgtcttcagatgaaaatgggggtacctatgtttca
cctcctggaaatgaagaggaagaatcaaaaatcttcaccactcttgaccctgcttctctg
gcttggctgactgaggaggagccagaaccagcagaggtcacaagcacctcccagagccct
cactctccagattccagtcagagctccctggctcaggaggaagaggaggaagaccaaggg
agaaccaggaaacggaaacagagtggtcattccccagcccgggctggaaagcagcgcatg
aaggagaaagaacaggagaatgaaaggaaagtggcacagctagctgaagagaatgaacgg
ctcaagcaggaaatcgagcgcctgaccagggaagtagaggcgactcgccgagctctgatt
gaccgaatggtgaatctgcaccaagcatga

DBGET integrated database retrieval system