KEGG   Homo sapiens (human): 2846Help
Entry
2846              CDS       T01001                                 

Gene name
LPAR4, GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2846 (LPAR4)
   04072 Phospholipase D signaling pathway
    2846 (LPAR4)
   04151 PI3K-Akt signaling pathway
    2846 (LPAR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2846 (LPAR4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2846 (LPAR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2846 (LPAR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    2846 (LPAR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 2846
NCBI-ProteinID: NP_001264929
OMIM: 300086
HGNC: 4478
Ensembl: ENSG00000147145
Vega: OTTHUMG00000021895
Pharos: Q99677(Tchem)
UniProt: Q99677
LinkDB All DBs
Position
Xq21.1
AA seq 370 aa AA seqDB search
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacagaagattcattgacttccaattccaagattcaaattcaagcctcagaccc
aggttgggcaatgctactgccaataatacttgcattgttgatgattccttcaagtataat
ctcaatggtgctgtctacagtgttgtattcatcttgggtctgataaccaacagtgtctct
ctgtttgtcttctgtttccgcatgaaaatgagaagtgagactgctatttttatcaccaat
ctagctgtctctgatttgctttttgtctgtacactaccttttaaaatattttacaacttc
aaccgccactggccttttggtgacaccctctgcaagatctctggaactgcattccttacc
aacatctatgggagcatgctctttctcacctgtattagtgtggatcgtttcctggccatt
gtctatccttttcgatctcgtactattaggactaggaggaattctgccattgtgtgtgct
ggtgtctggatcctagtcctcagtggcggtatttcagcctctttgttttccaccactaat
gtcaacaatgcaaccaccacctgctttgaaggcttctccaaacgtgtctggaagacttat
ttatccaagatcacaatatttattgaagttgttgggtttatcattcctctaatattgaat
gtctcttgctcttctgtggtgctgagaactcttcgcaagcctgctactctgtctcaaatt
gggaccaataagaaaaaagtactgaaaatgatcacagtacatatggcagtctttgtggta
tgctttgtaccctacaactctgtcctcttcttgtatgccctggtgcgctcccaagctatt
actaattgctttttggaaagatttgcaaagatcatgtacccaatcaccttgtgccttgca
actctgaactgttgttttgaccctttcatctattacttcacccttgaatcctttcagaag
tccttctacatcaatgcccacatcagaatggagtccctgtttaagactgaaacacctttg
accacaaagccttcccttccagctattcaagaggaagtgagtgatcaaacaacaaataat
ggtggtgaattaatgctagaatccaccttttag

DBGET integrated database retrieval system