KEGG   Homo sapiens (human): 3558Help
Entry
3558              CDS       T01001                                 

Gene name
IL2, IL-2, TCGF, lymphokine
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04151  PI3K-Akt signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
Network
nt06119  JAK-STAT signaling (virus)
nt06120  Calcium signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06220  Calcium signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Disease
H00084  Graft-versus-host disease
H00408  Type 1 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3558 (IL2)
   04151 PI3K-Akt signaling pathway
    3558 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3558 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3558 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    3558 (IL2)
   04660 T cell receptor signaling pathway
    3558 (IL2)
   04658 Th1 and Th2 cell differentiation
    3558 (IL2)
   04659 Th17 cell differentiation
    3558 (IL2)
   04672 Intestinal immune network for IgA production
    3558 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3558 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3558 (IL2)
   05321 Inflammatory bowel disease (IBD)
    3558 (IL2)
   05330 Allograft rejection
    3558 (IL2)
   05332 Graft-versus-host disease
    3558 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3558 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    3558 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3558 (IL2)
   05162 Measles
    3558 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    3558 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3558 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3558 (IL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3558 (IL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3558 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2 Plasmid_RAQPRD
Motif
Other DBs
NCBI-GeneID: 3558
NCBI-ProteinID: NP_000577
OMIM: 147680
HGNC: 6001
Ensembl: ENSG00000109471
Vega: OTTHUMG00000133075
Pharos: P60568(Tchem)
UniProt: P60568 Q0GK43
LinkDB All DBs
Structure
PDB: 

Position
4q27
AA seq 153 aa AA seqDB search
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system