KEGG   Homo sapiens (human): 377677
Entry
377677            CDS       T01001                                 

Gene name
CA13, CAXIII
Definition
(RefSeq) carbonic anhydrase 13
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
Drug target
Acetazolamide (DG01134): D00218<JP/US> D01196<JP/US>
Clofenamide: D01822
Diclofenamide: D00518<US>
Dorzolamide (DG01135): D00653<JP/US> D07871
Ethoxzolamide: D02441
Methazolamide: D00655<US>
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    377677 (CA13)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     377677 (CA13)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 377677
NCBI-ProteinID: NP_940986
OMIM: 611436
HGNC: 14914
Ensembl: ENSG00000185015
Vega: OTTHUMG00000164940
Pharos: Q8N1Q1(Tclin)
UniProt: Q8N1Q1
LinkDB
Structure
PDB: 

Position
8q21.2
AA seq 262 aa
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcgaggctcagctggggataccgcgagcacaacggtcctattcactggaaggaattt
ttccctattgctgatggtgatcagcaatctccaattgagattaaaaccaaagaagtgaaa
tatgactcttccctccgaccacttagtatcaagtatgacccaagctcagctaaaatcatc
agcaacagcggccattccttcaatgttgactttgatgacacagagaacaaatcagttctg
cgtggtggtcctctcactggaagctacaggttacggcaggttcaccttcactgggggtcc
gctgatgaccacggctccgagcacatagtagatggagtgagctatgctgcagagctccat
gttgttcactggaattcagacaaataccccagctttgttgaggcagctcatgaaccagat
ggactggctgtcttgggagtgtttttacagattggtgaacctaattcccaactgcaaaag
attactgacactttggattccattaaagaaaagggtaaacaaactcgattcacaaatttt
gacctattgtctctgcttccaccatcctgggactactggacatatcctggttctcttaca
gttccacctcttcttgagagtgtcacatggattgttttaaagcaacctataaacatcagc
tctcaacagctggccaaatttcgcagtctcctgtgcacagcggagggtgaagcagcagct
tttctggtgagcaatcaccgcccaccacagcctctaaagggccgcaaagtgagagcctct
ttccattaa

DBGET integrated database retrieval system